KEGG   Cellulophaga algicola: Celal_3536Help
Entry
Celal_3536        CDS       T01404                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cao  Cellulophaga algicola
Pathway
cao00480  Glutathione metabolism
cao00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Celal_3536
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Celal_3536
Enzymes [BR:cao01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Celal_3536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ADV50800
JGI: Celal_3536
UniProt: E6X8E4
Position
4041369..4041893
Genome map
AA seq 174 aa AA seqDB search
MKLTDKAKVTPTNSNELQKRSIYDIAINAINGTPISLKKFKGKKILFVNVASECGFTKQY
EDLQTLSDTYKDKLVVIGSPCNQFGKQEPGAASQIQEFCSLNFGVTFLLTEKIAVKGAKQ
HPLYEWLTHKSLNGKKSSSVKWNFQKYLVDDTGQFIDYYFSITKPLSSKIIKQL
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaacggataaagcaaaagtaacaccgacaaattctaatgaattgcaaaagcgt
tctatttatgatatagcaattaatgccataaatggaacacctatttctttgaaaaagttc
aaagggaaaaaaatactttttgttaatgtagcctcagaatgcggctttacaaaacaatat
gaagatttgcaaaccttgagtgatacctataaagataagttagttgttattgggtctcct
tgcaatcagtttggaaaacaagaacctggtgctgcatcacaaattcaggaattttgttca
ctaaattttggagttacttttttactcacagaaaagatagcagtgaaaggggctaagcag
catcctctttatgaatggctcacccataaatcattaaacggtaaaaagagttctagtgta
aaatggaatttccaaaaataccttgtagatgatacaggtcaatttatagattattatttt
tcgataacgaaaccactaagctcaaaaataattaagcagttgtaa

DBGET integrated database retrieval system