KEGG   Cellulophaga algicola: Celal_3568Help
Entry
Celal_3568        CDS       T01404                                 

Definition
maltooligosyl trehalose hydrolase (EC:3.2.1.141)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cao  Cellulophaga algicola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Celal_3568
Enzymes [BR:cao01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Celal_3568
Exosome [BR:cao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Celal_3568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4077465..4079279)
Genome map
AA seq 604 aa AA seqDB search
MAELEYKEMDMTIDKSRGMGAVLKEGKTTFRVWAPNAEKVYVMGSFNDWNRTNMPLGLEE
NGYWAAAFDSVKEGNEYKYIIHTNNQEYERNDPYAFEVTSSIGNSIVRKLDFDWGADTFK
MASWNELVIYELHVGTFNRKDADKVANFDSVIEKLPYLQDLGINCIELLPVAEFAGGISW
GYNPAHPFAIEQDYGGPDGFARLIKAAHEKGIAVIIDVVYNHLGPSDVDLWQFDGWGEND
KGGIYFYNDHRSQTPWGDTRPDYGRPEVRQYLRDNALMWIEKYKCDGLRMDATSYIRYEG
GGLGYDTEIEEGNILMRDINAELQQKYPQVLTIAEDLKGENKVTDAIEHNGLGYGSQWDM
NFVHPVREVLEDTYDNSRDLQKIVDALEFKYGNDVFTRIIYTESHDEVANGKARVPEEIQ
PGEADSSFAKKRAILGIALTLTAPGIPMLFQGQEFIEDKYFQDTEALDWGKYEKHQGIQK
LVRDLVFLRTGKEDRTAGLRDQGIKIVHFNDETKILAYIREDRNQEEHVLIIMNFSNMDY
IDYGIGLEDNHDWKLRFNSSWKGYDSDFSDLEIKGINHVEEETDGQNWTGKLTIPGYCCQ
IYTL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattagaatataaagagatggatatgaccatagacaaatctcggggaatggga
gctgttttaaaagaaggtaaaactacttttagggtttgggctccaaatgcagaaaaagtt
tatgtaatggggtcttttaacgactggaatagaacaaatatgcctcttgggctagaagaa
aatgggtattgggcagctgcttttgattcggttaaggaaggcaatgaatataaatatatt
attcatacgaataatcaagaatatgaacgcaacgatccatatgcttttgaagttactagt
agtattggtaattctatagttagaaaacttgattttgattggggtgctgatacgtttaaa
atggctagttggaatgaactagtaatttatgaactccatgtgggcacatttaatagaaaa
gatgctgataaggttgccaattttgatagcgttatagaaaaattaccctacttacaagac
ctaggaataaattgtatagaattattacccgttgcagaatttgcaggcggaatttcatgg
ggttacaaccccgcacatccatttgctattgaacaagattatggaggaccagatggtttt
gctagattaataaaagctgctcatgaaaaaggaattgctgtcatcatcgatgttgtgtac
aatcatttaggtccgtctgatgtagatttatggcagtttgatggatggggagaaaatgat
aaagggggaatttatttttacaacgatcataggagtcagaccccttggggagatactaga
cccgattatggtagacctgaagtaagacaatatcttagagataatgccttaatgtggata
gagaaatataaatgtgatggtttgcgcatggatgctacttcttatataagatatgaagga
ggcggacttgggtatgatactgaaatagaagaaggtaatattttaatgcgcgatataaat
gcagaactacaacagaaataccctcaggtattgacgatagcagaagatttaaaaggtgaa
aataaagttacagatgctattgaacataatggattagggtacgggagccaatgggatatg
aattttgtacatcctgtaagagaggttttagaagatacctatgacaattctagagatttg
caaaaaatagtagatgcgctagaatttaagtatggtaatgatgtattcacaagaattatc
tatacagaatctcatgacgaagttgccaacggcaaagctagagtgccagaagaaatacaa
cctggagaggctgatagttcctttgcaaaaaaacgtgccattcttggtatagcattaaca
ctaactgctcctggtattcctatgctttttcaaggtcaagagtttatagaagataaatat
tttcaagatacagaagctttagattggggaaaatatgaaaaacatcaaggcatacaaaaa
ctagtgcgggacttggtgttcttaagaactggtaaggaagatagaaccgcaggattaaga
gatcagggtattaaaatagttcattttaatgatgagactaaaattttggcctatatcaga
gaagatagaaaccaagaagaacatgtacttattattatgaactttagcaatatggattac
atagattatggaattggtctagaagataatcatgattggaaactgcgttttaatagctct
tggaaagggtatgattctgatttctcagatttagaaatcaaaggaattaaccatgtggaa
gaagaaacagatgggcaaaattggacaggaaaattaaccatccctggttattgttgccaa
atttacaccctataa

DBGET integrated database retrieval system