KEGG   Cellulophaga algicola: Celal_3777Help
Entry
Celal_3777        CDS       T01404                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cao  Cellulophaga algicola
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cao00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cao00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cao02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4329713..4331410
Genome map
AA seq 565 aa AA seqDB search
MSTKNTTRRKFIERTLLASGAIILAPNFISCKKDEDLTVSELDTTQLTIKNFNEGVASFD
PSSSSVLLWTRYASADAEIIWEVAIDPSFSSILRSGKITTETSRDHTIAIELTALNENLK
LYYRFANIADNALSATGETITLPEEASSVKLAVCSCSNYQAGLFNTYDAMANSNADIIVH
LGDYFYEYGAGGYGSTAENASLNRQHKPANEIITLEDYRTRYKQYRSDTDLQLAHQKKPF
ICVWDDHEIANDTYKNGAKNHDETTEGSFEIRKQNALQSYSEYLPFSRQDKDNNSIIYRT
INIGNLVNMIMLDTRLIGRDKQLSLANYFDATGLNTVALENDLNDPSRSILGTTQKEWLL
SELTSNTNQWQVLGQQVLMGQMDIPIAMLTAFGSENFAEILTELVTIKVRMQNNDPTLTD
AEKTKVLTTVPYNLDAWDGYPVDREQIYQALNGKKIVTLAGDTHNAWNNTLYAADGTEVG
IELATSSISSPGFETYLGTTDAAFITGFQQALTTLIDGLRYFDASKRGYMMTTFTKTEIT
SEWIYVDTILSSSYETSIGHTITYS
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccaagaacactacgagaagaaaatttatcgaaaggaccttattagcttcggga
gctattattttagctcctaattttataagctgtaaaaaagatgaagaccttacggtatca
gaattagataccacacaacttacaatcaaaaattttaatgaaggagtcgctagttttgat
ccaagtagttcttctgtattgttatggacccgctatgcttccgccgatgcagaaattatt
tgggaagtagctatagacccaagtttttcttcaattttacggagcggaaaaattacaaca
gaaacctcaagagaccatacaattgctattgaattaacagcgttaaatgaaaatttaaag
ctttactacaggtttgctaatatcgcagacaatgcactatctgctactggagaaacaatc
acacttcctgaagaagcttcttctgtaaaactggccgtatgttcttgttctaattaccaa
gctggtctatttaatacttatgatgctatggccaattcaaatgctgatatcattgtgcat
ttaggtgattatttttatgaatacggtgcgggtggttatggttcaacagcagaaaatgca
tctttaaaccgccaacataaacctgcaaatgaaattattacattagaggattatagaacc
aggtataaacaatatcgttctgataccgatctacaattagcccatcagaaaaaacctttt
atatgtgtttgggatgatcatgaaatagccaatgacacctataaaaatggtgctaaaaac
catgatgaaacaacagagggaagttttgaaattagaaaacaaaatgccttacaatcatat
agtgaatacttacctttttcaagacaagataaagacaataacagtataatttacagaact
ataaatattgggaatcttgtaaatatgattatgttagatacccgtcttataggtcgagat
aaacagttaagtctagctaattactttgatgctactggcttaaatacagtagctttagag
aacgatttaaatgatccttcaagaagtattttaggtactacacaaaaagagtggttgctt
agtgagttaacgagtaacaccaaccaatggcaagtattaggccaacaagttttaatgggg
caaatggatattcctattgcgatgcttaccgcttttggttctgaaaattttgctgaaata
ctcactgaacttgtaactataaaagtaagaatgcaaaacaatgatcctaccctaacagat
gcagaaaaaacaaaggttttaacaactgttccttataatttagatgcttgggatggatac
ccagtagacagagaacaaatatatcaggcattaaatggcaaaaagatagttactttagcg
ggggatacccataatgcttggaacaacacattatacgcagcagatggaacagaagtaggc
atagagcttgctacttctagtattagttctcctggttttgaaacttatttaggcacaaca
gatgccgctttcattactgggtttcaacaagcattaactacattaatagatggtttgcgc
tattttgacgcttctaaaagagggtatatgatgactacttttacaaaaactgaaattacc
tcagagtggatttatgtagatactattttatcgtcttcctatgaaacaagtattggtcat
accataacatattcataa

DBGET integrated database retrieval system