KEGG   Cellulophaga algicola: Celal_3892Help
Entry
Celal_3892        CDS       T01404                                 

Definition
lipolytic protein g-d-s-l family
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
cao  Cellulophaga algicola
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Celal_3892
Enzymes [BR:cao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Celal_3892
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Celal_3892
Lipid biosynthesis proteins [BR:cao01004]
 Fatty acid synthase
  Component type
   Celal_3892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4462349..4463095
Genome map
AA seq 248 aa AA seqDB search
MSKAQNKQLHSYLPTSISAKLLKFCYFLMAVLLYSCGDAKTEQATEDASTPKKTEDILAT
NATTKTILCFGDSITAGYGLDDNNNAYPGLVQKKLDSLGLKFTVINSGVSGETTAGGKSR
IDWVIKQTPSIFLLELGANDGLRGVALSETRANLQAIIDVVRKKSPNTTIILAGMQLPPN
MGLAYTTEFKQLFIDLAEKNTLEFIPFILKDVGGIAALNQKDGIHPNIEGHKILANTVWD
VLQPLLKS
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggcccaaaataaacaattgcattcatatctgccaacatctataagcgctaaa
ctcctaaagttttgttattttctaatggccgtcctactctactcctgtggtgatgccaaa
acagaacaggcaacagaagatgcgagcactcctaagaaaacagaagatattttagcgaca
aatgccacgaccaaaaccattctatgttttggtgatagcattacggcaggttatggtctt
gatgataataacaatgcctaccctggtctagtacaaaaaaaattagattctttaggtctt
aaatttacagtgattaattctggagtaagtggtgaaactactgctggcggcaaaagcaga
attgattgggtaattaaacaaacacctagcatatttctcctagaacttggtgctaatgat
ggtttgcgtggtgtagctttgtctgaaacacgtgcaaatttacaagcaatcattgatgtg
gtgcgaaagaaaagtcccaataccacgattatccttgccggaatgcaattgcctccaaat
atgggcctagcatatacgactgaatttaaacaactgtttatagacttggcggagaagaat
acattagaatttattccttttattttgaaagatgttggtgggattgctgcattaaaccaa
aaggatggcattcacccaaacatagaaggtcataaaatcttagcaaatacggtttgggat
gtattacaaccattattgaagtcctaa

DBGET integrated database retrieval system