KEGG   Cellulophaga algicola: Celal_3912Help
Entry
Celal_3912        CDS       T01404                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cao  Cellulophaga algicola
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Celal_3912
Enzymes [BR:cao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Celal_3912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4485821..4487590)
Genome map
AA seq 589 aa AA seqDB search
MKKSNFKQRINACLFFTSLLCSSFVLQAQNYCSSTPVAVHGSLSVSGNKIVDKNNNPVSF
AGNSFFWSNSGWGAEKYYNADVVNWLAADWNTTIVRAAMGVEDSGGYLSNPTENKNRVKA
VVDAAIAKGIYVIIDWHSHHAEDNEAAAISFFKEMAQTYGNNPHVIYEIYNEPLQVSWSN
TIKPYAEKVSAAIRAIDPDNLIIVGTSTWSQDVDIASNDPITSTTNIAYTLHFYAATHKE
SLRQKAQTALNNGVALMVTEWGSVEASGNGAVDTASTDAWMSFLATNNITHANWSLHDKS
EGASVLNPGASSTGGWAASNLTASGIKVKSIVKNWKQYCTDGGTGGGTTNQKPSVSITSP
TANSSSATGTTIQVKATASDADGTVTQVTFYANGSLIGTDVSSPYTQSWNPASGDYSLTA
IATDNAGAKTTSTAVTVTIGTLPGGGGTCTNVPVWNANTVYANAEAQVVFNGNIYKNNWY
TKNQSPATNSGQWQVWTLVSSCTTINATSASSEIKIYPNPSSDKIQIEVGDTEDFSRITI
LDFQGSVVYENKITSKGTIEIPLNNYKEGMYFVKLSGKKEVTKSFIKKP
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagtaactttaaacaaagaataaacgcctgtttattcttcacaagtctattg
tgtagttccttcgtcttacaagcacaaaattactgttcttctacacctgtagcagttcac
ggtagtttaagcgtaagtgggaataagattgtagacaaaaacaataaccctgtaagtttt
gctggaaatagttttttctggtccaatagcggatggggggcagagaaatattacaacgct
gatgttgtaaattggttggctgctgattggaatacaactattgtgagagcagcaatggga
gtagaagattctggagggtatttgagtaaccctactgagaataaaaacagagttaaagcg
gtagtagatgctgcgatagctaaaggtatttatgttattatagattggcattctcatcat
gcagaggataatgaagctgctgcgatttcttttttcaaagaaatggctcaaacctacggc
aacaatccacatgtaatttatgagatttacaatgagcctttacaagtatcttggtctaat
accattaagccgtatgcagaaaaagtaagcgcagccattagagctatagatcctgataat
ttaattattgttggaacatctacttggtctcaggatgtagatattgcttcaaatgatcct
attaccagtaccactaatattgcatatactttgcatttttatgcagcaacgcataaagaa
agtctacgccaaaaagcacaaacagcattgaacaatggggttgcgcttatggttaccgaa
tggggtagtgtagaagctagtggtaatggtgcggtagatacagcctctaccgatgcttgg
atgtcttttttagctactaataatattacgcatgctaattggtctcttcatgataaaagt
gaaggagcttctgtcttaaatccaggagcaagttcaacaggaggttgggcagcttctaat
ttaacagcttcaggtattaaagtaaaaagtattgtgaaaaactggaaacagtattgcaca
gatggtggaactggtggtggtacgaccaatcaaaaacctagcgtgagtattacaagtcct
acggcaaacagctcttctgctacaggaactacgattcaagtaaaagctactgctagtgat
gcggatggcacagtaactcaagttacattttatgcaaacgggagccttattggtacagat
gtgagtagtccttatacacaaagttggaaccctgcatcaggagattatagtttaacggct
atagcaactgataatgcgggagccaaaactacaagtactgcagtgacagttactatagga
actttgcctggtggtggaggaacctgtactaatgtaccggtatggaatgccaataccgtg
tatgcgaatgccgaagctcaagttgttttcaatgggaatatttataaaaataactggtat
acaaaaaaccaaagtcccgctaccaattcgggacaatggcaggtgtggactttagtaagt
tcttgtaccacaataaatgctacaagcgcgagctctgaaataaaaatatacccgaatcct
tccagtgataaaatacaaattgaagttggtgacaccgaagatttttctagaataaccatt
ttagattttcaaggaagcgtagtgtatgagaataaaatcacctcaaaaggaactattgaa
attcctttaaataactataaagagggaatgtattttgtgaaactatcgggtaaaaaagaa
gttaccaaaagctttattaaaaagccgtaa

DBGET integrated database retrieval system