KEGG   Cellulophaga algicola: Celal_4075Help
Entry
Celal_4075        CDS       T01404                                 

Definition
(GenBank) Cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
cao  Cellulophaga algicola
Brite
Enzymes [BR:cao01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Celal_4075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C Paired_CXXCH_1
Motif
Other DBs
NCBI-ProteinID: ADV51318
JGI: Celal_4075
UniProt: E6XEJ0
Position
4661556..4662716
Genome map
AA seq 386 aa AA seqDB search
MSIKFYTSIFLLSIILWSCGNPSVGKPKAVPTVAALPKEIKTPLNNPNTAEKVQLGKLLF
YDPILSGGKDISCVSCHHPATGYAEFLDLSIGSNGKGLGSKRVFNTPNTIPLMKRNSPTI
LNTAYNGIQEKGDYDPEAAAMFWDDRIKSLEKQALEPIKTLEEMRGHHFDKNQILTEVAV
RLEAIPEYKKRFAAAFGSHEPIDSIHIAKAIAAFERTLVANNSRFDQYMSGDSTAISLAE
KEGLALFKSVGCINCHSGPMFSDYKLHVIGVPENKKVLVPDSGAEERFAFRTPSLRNLRF
TAPYMHNGVFQNLKEVLEFYEDISVGKTRNESVSKAMFDPLVDDLELSVKEMSLLVSFLN
TLNNDNFDKEIPLTVPSGLAVGGNIH
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagtattaaattttatacctccatctttttactctccattattttatggagctgtggg
aaccctagtgttggaaaacctaaagccgtacctaccgtagctgccttaccaaaagaaatt
aaaacacctttgaacaatcctaatactgctgaaaaagtacaattagggaaactcttattt
tatgaccctattctctctggtggtaaagatatttcttgcgtaagttgccatcatcctgca
acgggttatgctgaatttttagacctatctattggtagtaatggaaaaggcttaggtagc
aaacgagtttttaataccccaaacactattccgctgatgaagcgcaattctcctactatt
ttaaataccgcctataatggcattcaggaaaaaggcgattatgatcctgaagcggccgct
atgttttgggatgaccgcatcaaaagcttagagaaacaagctttagagcctatcaaaacc
ttagaagaaatgagggggcatcattttgataaaaatcagattttaactgaggtagcagta
cgacttgaagccatcccagaatacaaaaaacgctttgccgcagcatttggctcccatgaa
cccatagatagtattcatattgcaaaagctatcgctgcttttgaacgcactttggtcgcc
aataattcgcgctttgatcagtatatgtctggagacagcactgctatttccttagctgaa
aaagaaggtttagcgctatttaaatctgtgggatgtattaattgccatagcggtcctatg
ttctctgattacaagctgcatgtgattggtgttcctgaaaacaaaaaagtgttggtgcca
gacagcggtgctgaagagcgttttgcttttagaacaccctcattacgcaacctacgtttt
actgctccctatatgcacaatggcgtatttcaaaatttgaaagaagttttagaattctat
gaagatatctccgtaggcaaaacaagaaatgaatcggtttctaaagccatgtttgaccct
ttggtagatgatttggagctaagtgttaaagaaatgtcgctactagtttcatttttaaat
acgttgaataatgataatttcgacaaagaaattccccttactgttcctagtggattggcc
gtaggaggtaatatccattaa

DBGET integrated database retrieval system