KEGG   Cellulophaga algicola: Celal_4143Help
Entry
Celal_4143        CDS       T01404                                 

Definition
magnesium chelatase subunit chli family protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cao  Cellulophaga algicola
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cao00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4732456..4733925)
Genome map
AA seq 489 aa AA seqDB search
MKLNYNEINTLGELKKAGYQSKSIKDELRDNLRDKIKNGEETFVGVWGYENSVIPELERA
ILSRHNINLLGLRGQAKTRLARLMVNLLDENIPVVGGSEINDDPLKPMSRYAIELIKDKG
DATPITWLHRSERFSEKLATPDVTVADLIGDVDPIKAANLKLSYADDRVIHFGMIPRANR
CIFVINELPDLQARIQVSLFNILQEGDIQIRGFKLRLPLDIQFVFTANPEDYTNRGSIVT
PLKDRIGSQILTHYPEDIATARKITEQESKLDTRQTDAVYVPDIAKDLLEQISFEARESE
YVDAKSGVSARTSITAFENLLSTAERRALLTGADSTMVRLSDFLGIIPSITGKIELVYEG
EQEGADGVAAILIDDAVKTLFPTYFPEINKLEKKGEETPYDELLHWFFEGDGFELLDEYT
DEEYKRALDDIPALNQLLKEYQPEYAEKDVYFLKEVLLWGLVAYKKLNKNRFEEGYQFKD
MYSSFFTDL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaattataacgaaataaatacattgggtgagctgaaaaaagctggttaccaa
agtaagagtataaaagatgaacttagagataatttaagggataaaataaaaaatggagaa
gagacctttgttggggtttgggggtatgaaaattctgtaattccagaattagaaagggct
attctttcaaggcataatataaatttattgggtttaagagggcaggcaaaaaccaggtta
gcacgtttgatggtaaatttgttagatgaaaatatccctgtagttggtgggtcagaaatc
aatgacgatccgttaaagccaatgtcacgttatgcaattgaattaatcaaggataaaggt
gatgctacgcctattacgtggttacacagaagcgaacgtttttcagagaaattagcaact
ccagatgttacggtggcagatttaattggagatgtagatcctattaaagctgcaaattta
aaattatcgtatgcagatgatcgtgtaatccattttggaatgatacctagagccaacagg
tgtatttttgtaattaatgaattgccagatctacaagctcggattcaggtatctttattt
aacattttacaagaaggtgatattcaaattcgtggatttaaattgcgtttacctttagat
attcagtttgtatttactgcaaatcctgaagactatactaatagagggagtattgttacg
cctttaaaagatagaataggttcacagattttaacgcattatccagaagatatagcaact
gctcgcaaaataacagaacaagagtctaagttagatacccgacaaacagatgctgtgtat
gttccagatatagcaaaagatttattagagcaaattagctttgaggctcgtgaaagtgaa
tatgtagatgcaaagagtggagtaagtgcccgtacgagcataacagcttttgagaattta
ctgagtacagcagaacgtagagcattattaacgggagcagatagtacaatggttcgtttg
agtgatttcttaggtattattccttctattacaggtaaaatagaattggtttatgaagga
gagcaagaaggggcagatggtgtagctgcaattttaattgatgatgccgttaaaacatta
ttccctacatattttcctgaaataaataaattagagaaaaaaggagaagaaacaccttat
gatgagttattgcattggttttttgaaggagacggttttgaacttttagatgaatatacc
gatgaggaatataaaagagcgttagatgatattccagccttaaatcagttactaaaagaa
tatcaaccagagtatgctgaaaaagatgtttatttcttaaaagaagtattactttgggga
ctcgtagcttataagaagttgaataagaatcgttttgaagaaggctatcaatttaaagat
atgtatagcagtttttttactgatttgtaa

DBGET integrated database retrieval system