KEGG   Cellulophaga algicola: Celal_4209Help
Entry
Celal_4209        CDS       T01404                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cao  Cellulophaga algicola
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:cao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Celal_4209
   01230 Biosynthesis of amino acids
    Celal_4209
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Celal_4209
   00030 Pentose phosphate pathway
    Celal_4209
   00051 Fructose and mannose metabolism
    Celal_4209
   00052 Galactose metabolism
    Celal_4209
  Energy metabolism
   00680 Methane metabolism
    Celal_4209
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Celal_4209
Enzymes [BR:cao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Celal_4209
Protein phosphatases and associated proteins [BR:cao01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Celal_4209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4800363..4801586)
Genome map
AA seq 407 aa AA seqDB search
MASKSILIICGGGPAPGINAVISTVAKIFLKDGYRVLGLHEGFKGIFSENPEIKEFDFAH
ADRIFSRGGSTLIMSRFKPSDEKINTELFAQNNVKLLVSIGGDDTASTANRITTYLSKEN
ISIANIHVPKTIDNDLPLPDRNPTFGFHSAKDEGVRIGNTTYEDARTSQNWFVMSTMGRS
AGHLAFGIAASCHFPMMVIPEMFNKTEVTFDKVVRLIISSIIKRKIENINYGVALISEGI
FHIMPDSELQNCGINFTYDDHGHPELGNVSKSHIFNMLVQRKLKELGVNIKSRPVELGYE
LRCCRPIGFDLTLCTLLGLGVKKLYDEGISGCIVTANSKGEISPLYLKDLQDKEGKIAPR
LVDINSEFAKLCFQNLHYLTESDFDKAKQYLDNPKDYYFNDILEDAY
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcttctaaatctatattaattatttgcggcggaggcccagcacctggtataaatgct
gtgataagcacagttgccaaaatctttttgaaagatggctaccgagttcttggattacat
gaaggttttaaaggaattttttctgaaaaccctgaaataaaagaatttgattttgcacat
gcagatcgtatattcagtcgtggtggatcaacactaataatgagtaggtttaagccaagt
gatgagaaaatcaacacagagctttttgctcaaaataatgtaaaactattagtcagtatt
ggcggtgatgacaccgcttctacggctaatagaattacaacatacctatctaaggaaaat
atttctatagccaatattcatgtacccaaaactatagataatgatcttcccttaccggat
agaaatcctacatttggttttcattctgctaaagatgaaggtgttaggattggtaatacc
acatatgaagatgcgcgtacgagtcagaattggttcgtaatgtcaaccatgggtagatca
gcagggcatttagcttttggtattgctgccagttgtcattttccaatgatggttattcca
gaaatgtttaataaaaccgaagtgacttttgataaggtggttcgtttaattatttcatca
ataatcaaacgaaaaatagaaaacataaattatggggtagcactaatcagtgagggtatt
tttcatattatgccagattcagagctccaaaattgcggtattaatttcacctatgatgac
cacggacatcctgaacttggtaatgtaagtaaatctcatatttttaatatgctggttcaa
cgtaaattaaaggagctaggagtaaatattaaaagtagaccagttgaattagggtatgaa
cttcgctgttgcaggcctattgggtttgatttaacgctatgtactttattgggactagga
gttaaaaaactgtatgatgaaggaataagtggttgtattgttacggcaaattctaaagga
gaaataagtcctttatatttaaaagatttacaagataaagagggtaaaatagcacctcgt
ttagtagatattaattctgaatttgcaaaattgtgtttccagaatttacattatttaact
gaaagtgattttgataaagcaaaacaataccttgacaatcctaaagattattattttaat
gatattttagaagatgcatactaa

DBGET integrated database retrieval system