KEGG   Caldilinea aerophila: CLDAP_00050Help
Entry
CLDAP_00050       CDS       T01797                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cap  Caldilinea aerophila
Pathway
cap00010  Glycolysis / Gluconeogenesis
cap00260  Glycine, serine and threonine metabolism
cap00680  Methane metabolism
cap01100  Metabolic pathways
cap01110  Biosynthesis of secondary metabolites
cap01120  Microbial metabolism in diverse environments
cap01130  Biosynthesis of antibiotics
cap01200  Carbon metabolism
cap01230  Biosynthesis of amino acids
Module
cap_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cap_M00002  Glycolysis, core module involving three-carbon compounds
cap_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLDAP_00050 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CLDAP_00050 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLDAP_00050 (gpmA)
Enzymes [BR:cap01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CLDAP_00050 (gpmA)
Membrane trafficking [BR:cap04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CLDAP_00050 (gpmA)
Exosome [BR:cap04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CLDAP_00050 (gpmA)
  Exosomal proteins of melanoma cells
   CLDAP_00050 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAL98044
UniProt: I0HYF7
Position
6077..6823
Genome map
AA seq 248 aa AA seqDB search
MYKVVLLRHGESTWNKENRFTGWTDVDLSERGREEAQRAGEVLRSEGYTFDVAFTSVLKR
AIRTLWYVQDVLDLMWIPTFKAWQLNERHYGALQGLNKAEMAAQYGEEQVLIWRRSYDVP
PPPLTPDDERYPGHDRRYAGLSKEQLPLTESLKDTVARVLPYWNAEIAPVIKAGKRVIIA
AHGNSLRALVKYLDNLSEEAIIKLNIPTGIPLVYELDEALKPIKSYYLGDPEEVAKAAAA
VAAQGKAR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagttgtgttgcttcgtcatggcgagagcacctggaacaaggaaaatcgtttc
acaggctggacggacgttgacctgtccgaacgcggccgcgaggaggcacagcgtgcaggc
gaggtgttgcgcagcgagggctacacgttcgacgtcgccttcacgtcggttctgaagcgc
gccattcgcacgctctggtatgtgcaggatgtgcttgacctgatgtggattccgaccttc
aaggcctggcagctcaacgagcggcactacggagcgctgcaggggttgaacaaggcggag
atggcggcccaatacggggaggaacaggtgctgatctggcgacgcagctacgatgtaccg
ccgccaccactcacgccggacgatgagcgctatcctggccatgaccgccgctacgccggc
ctgagcaaggagcagttgccgctcaccgagtcgctcaaagacacggtggcacgtgtgctt
ccttactggaacgcagagatcgcgccggtgatcaaggcaggcaaacgggtcatcattgcg
gcccatggcaacagcctgcgcgcgctggtcaagtatctggacaatctcagtgaggaagca
atcatcaagctcaacattcccaccgggattccgctggtttatgagctggatgaggcgctg
aagccgatcaaaagctattacctcggcgatccagaggaggtggccaaagctgccgcggcc
gtcgccgcgcagggtaaggcccggtaa

DBGET integrated database retrieval system