KEGG   Caldilinea aerophila: CLDAP_02700Help
Entry
CLDAP_02700       CDS       T01797                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cap  Caldilinea aerophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CLDAP_02700 (glgB)
Enzymes [BR:cap01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CLDAP_02700 (glgB)
Exosome [BR:cap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLDAP_02700 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
365143..367548
Genome map
AA seq 801 aa AA seqDB search
MQPPIRTEKEVEPQVGETPEEKTINAIQPADAVQPTGLSSAAGVASTEPTPPEPAQAAAP
DEPETTADRAEIEAIVGGYHGAPYQILGPHLVQVEGQEMVAIRVFRPLDKAVDVLDIASG
ERTPMKRVHPAGFFEATFPERKEIFPYRIVVLGGDDVEYELEDPYRFPLLLTDFELYLHG
EGNFLESYERLGAHIRTVEGVQGVHFAVWAPNALRVSVIGPFNAWDNRVNPMQRRGDGGV
WETFIPNLPKGTHYKYSIKSQFLGYEIDKSDPYGFYFEVRPSTDTRVWDIDSYQWNDQEW
MERRAQTQALDRPMSIYEVHLGSWRRGEGNAFLSYRELAHQLVDYVKEMGYTHIELMPIA
EHPLDGSWGYQVTGYYAPTSRFGTPDDFMYFVDYCHQHGIGVLLDWVPAHFPRDAHGLAF
FDGTHLYEHADPRQGEHRDWGTKIFNYGRNEVRNFLLSNALFWLKKYHIDGLRVDAVASM
LYLDYSRSPGEWIPNKYGGRENLEAIDFLRRFNELVHEHVPGAITCAEESTSWPMVTRPT
YMGGLGFDYKWNMGWMHDTLSYMQKDPIYRRYHQNEITFSLIYAFHENFILPFSHDEVVH
LKKSMLDKMPGDVWQKFANLRALYAYMYGHPGKKLLFMGGEFGQWAEWSEARSLDWHLLQ
FEEHRKLQRFVRDLNHFYRHEPALFEIDSSWEGFQWIDFTDAEQSVISFQRRAKEPAEML
IFVCNFTPVVRESYRVGLPISGLYQEVLNSDWTIYGGSGVTNSGLIAAQELPWQNCKFSA
PLRLPPLGVFVLKPVKPPSQQ
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
gtgcagccgccgatccggactgaaaaagaggttgagcctcaagtcggcgaaaccccggaa
gagaagacgataaacgctattcaaccggcagacgccgttcagccgacggggctatcaagc
gctgcaggtgtcgcctccactgagcccacaccgcccgaacccgctcaggcggccgcgcca
gacgagcctgagacaacggcggatcgcgccgaaatcgaagcgatcgtcggcggctatcat
ggcgcgccctatcagatcttggggcctcatctggtgcaggtcgaggggcaggaaatggtg
gcgatccgcgtctttcgcccgcttgacaaggcggtcgatgtactggacatcgccagcggc
gaacgcacgccgatgaaacgagtccacccggccggtttctttgaagcgacattcccagag
cgcaaggagatctttccctatcgcatcgttgtgttgggtggggatgacgtcgagtatgaa
ctggaagatccctatcgttttcccttgctgcttacggactttgaactctatctgcacggc
gagggcaatttcctggaaagctatgaacgcctgggcgcacacatccgcactgtggagggc
gttcaaggcgtacactttgcggtatgggcgccaaacgccctgcgcgtcagcgtgattggg
cctttcaacgcctgggacaaccgcgtcaacccgatgcaacgccgtggggacggcggcgtc
tgggagaccttcatccccaacttgccgaaagggacccattacaaatattcgatcaagtcc
cagtttctaggctatgaaatcgacaaatccgatccttatggcttctactttgaggtgcgt
cccagcaccgacacgcgggtatgggacatcgattcgtaccagtggaacgatcaggagtgg
atggagcgccgcgcgcagacgcaggcgctggatcggccgatgagcatctacgaagtgcac
ctcggaagctggcgtcggggagaagggaatgcatttctcagctatcgcgagctggcgcac
caactggtggactacgtaaaagagatgggctacacccatatcgagctgatgccgatcgcc
gagcaccctttggatggctcctgggggtatcaggtgaccggttattacgcgccgaccagc
cgcttcgggacaccggacgacttcatgtatttcgtcgactattgccatcagcatggcatc
ggtgtgctgttggactgggtgcccgcgcacttcccgcgcgatgcacacggcctggccttc
tttgatggcacccatctctacgaacacgccgatccgcgccagggcgaacatcgtgactgg
ggcaccaaaattttcaactacggacgtaacgaagtacgcaacttcttgctgagcaacgcg
ctcttctggctcaaaaaataccacatcgacggcctgcgcgtcgatgccgtcgcctccatg
ctctatctggactacagccgcagccctggagagtggatccccaacaaatacggcggtcga
gaaaacctggaagccattgactttttgcgccgcttcaacgagcttgtgcacgagcacgtt
cccggcgctatcacctgcgccgaagaaagcacctcctggccgatggtgacccgccccacc
tacatgggcggcctcggctttgactacaaatggaacatggggtggatgcacgacaccctc
agctacatgcagaaagaccccatctatcggcgctaccatcagaacgagatcaccttcagc
ctgatctatgccttccacgagaacttcattttgcccttcagccacgacgaggtggtacat
cttaagaaatcaatgctcgacaagatgcccggtgatgtctggcagaaattcgccaatctg
cgtgcgctttacgcatacatgtatggacatcccggcaaaaagctgttgttcatgggcggc
gaattcggacaatgggctgaatggagcgaagcgcgcagcctggattggcacctcctacaa
tttgaagagcaccggaagctgcaacgcttcgtgcgcgatctgaaccatttctatcgccat
gagccggcactctttgaaattgattccagttgggagggctttcagtggattgatttcacc
gacgccgagcagtcggtcatcagctttcagcgccgtgccaaggagcccgcggagatgctc
atttttgtctgcaactttacacctgtcgtgcgagagtcctatcgcgtcgggctgccgatc
agtggcctttatcaggaagtgctgaacagcgactggacgatctacggcggcagcggggtc
accaattcaggactgatagccgctcaggagttaccctggcaaaattgtaagttctcagct
ccgcttcgtttgcctccattgggcgttttcgtccttaagccggtgaagcccccatcgcaa
caataa

DBGET integrated database retrieval system