KEGG   Caldilinea aerophila: CLDAP_03470Help
Entry
CLDAP_03470       CDS       T01797                                 

Gene name
rocF
Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cap  Caldilinea aerophila
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cap01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cap00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(457981..458910)
Genome map
AA seq 309 aa AA seqDB search
MENNLHPRRVKIVGVPMDLGQQRRGVDMGPSAVRYAGLYDRLTQLGHAVHDIGNVPVAGR
DEEDVRSERWIEMAGGGLRHLSAVTAACHAIYDVAQKLPVEDFPIFLGGDHSMAIGTVSG
MVTKGPLGVIWIDAHGDYNTPETTPSGNIHGMPVAALSGFGHPDLVNLGVTGAKLRPQDI
VMIAVRDLDPQERIALAHSGIIVYTMRDIDELGMATVARRALARLNRMPRIHVSLDMDAL
DPTVAPGVGTPVAGGLTFREAHLLMEILAESGKVCSLDIVEINPILDEGNRTAEVAVALT
ASLLGQQIL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaatctgcatccacgcagggtgaagatcgtgggcgtgccgatggacctggga
caacaacggcgaggggtggatatggggccaagcgccgtgcgctacgctggcttatacgac
cgcttgacgcagcttggccacgccgtgcatgacatcggcaacgttcctgttgccggtcgc
gacgaagaggatgtgcgcagcgagcgctggatcgagatggctggcggcggcttgcgccac
ctctcggcggtgacggcggcctgccatgccatctatgacgtggcacaaaagttgcctgtg
gaggacttccctatctttctgggcggcgaccattcgatggcgatcggcacggtcagcggc
atggtgacgaaggggccactcggcgtcatctggatcgatgcgcacggcgactataacacg
ccggagacgacaccctctggcaacattcacggcatgccggtggcggcactcagcggcttc
ggccatcccgatctggtcaatctgggtgtaactggcgccaaactgcgcccgcaggacatc
gtcatgatcgctgtgcgcgacctggatccgcaggagcgcattgcgctggcgcacagcggc
atcatcgtctacaccatgcgggacatcgacgaactgggcatggcaacggtggctcgccgc
gccctggcgcggcttaaccgtatgccgcgcatccacgtcagcctcgatatggatgcgctc
gacccgaccgttgcgcccggtgtcggcacgccggtggcgggcggcctgacctttcgcgag
gcacatctgctgatggaaatcctggctgagtcgggaaaagtctgttcgctcgatatcgtg
gaaattaacccaattctcgatgagggcaaccgcacagcggaggtagcagtggcgttgacg
gcgtcacttttaggccagcagattttgtaa

DBGET integrated database retrieval system