KEGG   Caldilinea aerophila: CLDAP_03710Help
Entry
CLDAP_03710       CDS       T01797                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cap  Caldilinea aerophila
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLDAP_03710 (tpiA)
   01230 Biosynthesis of amino acids
    CLDAP_03710 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLDAP_03710 (tpiA)
   00051 Fructose and mannose metabolism
    CLDAP_03710 (tpiA)
   00562 Inositol phosphate metabolism
    CLDAP_03710 (tpiA)
Enzymes [BR:cap01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLDAP_03710 (tpiA)
Exosome [BR:cap04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLDAP_03710 (tpiA)
  Exosomal proteins of bladder cancer cells
   CLDAP_03710 (tpiA)
  Exosomal proteins of melanoma cells
   CLDAP_03710 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
489172..489924
Genome map
AA seq 250 aa AA seqDB search
MMAGNWKMNKTVDEAIALARAICEQVNHIANVDRVVCPPFIAIPAVSETLRGSQIAVGAQ
NMHWAESGAYTGEISAPMLKGFASYVIIGHSERRQYFAETDETVNKKAHSAVAAGLTPII
CVGESLEQNERGETQSFVSSQVRAALAGFTAEQVKQLIIAYEPIWAIGTGRAATAQQANA
ICGDVVRKTVGEMFGEEAAAAIRILYGGSTNEKNIGEIMAQPDIDGALIGGASLKVESYA
AMVKITSELY
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgatggctggcaactggaaaatgaataaaacagtcgacgaagccatagcgctggcacgc
gctatctgcgaacaggtcaatcacatcgctaacgtggaccgtgtggtctgcccccctttc
attgccatccccgccgtgagcgaaacgctgcggggcagccagatcgctgtcggcgcgcag
aacatgcactgggctgaaagcggcgcctacacgggggagatcagtgccccaatgctcaaa
ggcttcgcaagctacgtgatcatcggccatagcgaacgccggcagtatttcgccgaaact
gacgagacggtcaacaagaaggcgcatagcgccgtggccgccggcctgacgccgatcatc
tgcgtcggcgaatcactggagcagaatgagcgcggggagacccagtccttcgtcagcagc
caggtgcgcgcagcgctggccggtttcaccgccgagcaggtgaagcagctcatcatcgcc
tatgaaccgatctgggcgattggaacgggcagggcagccaccgcacagcaagccaatgca
atttgcggggacgtggtgcgcaagacggtgggcgagatgttcggcgaagaagctgctgcc
gccattcgtatcctctacggtggcagcaccaatgaaaaaaacatcggtgaaatcatggca
cagcccgacatcgacggcgccttgatcggcggcgcatcgctcaaggtcgagagctacgct
gccatggtgaaaatcacaagtgagctgtattga

DBGET integrated database retrieval system