KEGG   Caldilinea aerophila: CLDAP_03710Help
Entry
CLDAP_03710       CDS       T01797                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cap  Caldilinea aerophila
Pathway
cap00010  Glycolysis / Gluconeogenesis
cap00051  Fructose and mannose metabolism
cap00562  Inositol phosphate metabolism
cap01100  Metabolic pathways
cap01110  Biosynthesis of secondary metabolites
cap01120  Microbial metabolism in diverse environments
cap01130  Biosynthesis of antibiotics
cap01200  Carbon metabolism
cap01230  Biosynthesis of amino acids
Module
cap_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cap_M00002  Glycolysis, core module involving three-carbon compounds
cap_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLDAP_03710 (tpiA)
   00051 Fructose and mannose metabolism
    CLDAP_03710 (tpiA)
   00562 Inositol phosphate metabolism
    CLDAP_03710 (tpiA)
Enzymes [BR:cap01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CLDAP_03710 (tpiA)
Exosome [BR:cap04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CLDAP_03710 (tpiA)
  Exosomal proteins of bladder cancer cells
   CLDAP_03710 (tpiA)
  Exosomal proteins of melanoma cells
   CLDAP_03710 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: BAL98410
UniProt: I0HZH3
Position
489172..489924
Genome map
AA seq 250 aa AA seqDB search
MMAGNWKMNKTVDEAIALARAICEQVNHIANVDRVVCPPFIAIPAVSETLRGSQIAVGAQ
NMHWAESGAYTGEISAPMLKGFASYVIIGHSERRQYFAETDETVNKKAHSAVAAGLTPII
CVGESLEQNERGETQSFVSSQVRAALAGFTAEQVKQLIIAYEPIWAIGTGRAATAQQANA
ICGDVVRKTVGEMFGEEAAAAIRILYGGSTNEKNIGEIMAQPDIDGALIGGASLKVESYA
AMVKITSELY
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgatggctggcaactggaaaatgaataaaacagtcgacgaagccatagcgctggcacgc
gctatctgcgaacaggtcaatcacatcgctaacgtggaccgtgtggtctgcccccctttc
attgccatccccgccgtgagcgaaacgctgcggggcagccagatcgctgtcggcgcgcag
aacatgcactgggctgaaagcggcgcctacacgggggagatcagtgccccaatgctcaaa
ggcttcgcaagctacgtgatcatcggccatagcgaacgccggcagtatttcgccgaaact
gacgagacggtcaacaagaaggcgcatagcgccgtggccgccggcctgacgccgatcatc
tgcgtcggcgaatcactggagcagaatgagcgcggggagacccagtccttcgtcagcagc
caggtgcgcgcagcgctggccggtttcaccgccgagcaggtgaagcagctcatcatcgcc
tatgaaccgatctgggcgattggaacgggcagggcagccaccgcacagcaagccaatgca
atttgcggggacgtggtgcgcaagacggtgggcgagatgttcggcgaagaagctgctgcc
gccattcgtatcctctacggtggcagcaccaatgaaaaaaacatcggtgaaatcatggca
cagcccgacatcgacggcgccttgatcggcggcgcatcgctcaaggtcgagagctacgct
gccatggtgaaaatcacaagtgagctgtattga

DBGET integrated database retrieval system