KEGG   Caldilinea aerophila: CLDAP_04910Help
Entry
CLDAP_04910       CDS       T01797                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cap  Caldilinea aerophila
Pathway
cap00010  Glycolysis / Gluconeogenesis
cap00052  Galactose metabolism
cap00500  Starch and sucrose metabolism
cap00520  Amino sugar and nucleotide sugar metabolism
cap00521  Streptomycin biosynthesis
cap01100  Metabolic pathways
cap01110  Biosynthesis of secondary metabolites
cap01120  Microbial metabolism in diverse environments
cap01130  Biosynthesis of antibiotics
cap01200  Carbon metabolism
Module
cap_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cap_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLDAP_04910 (glk)
   00052 Galactose metabolism
    CLDAP_04910 (glk)
   00500 Starch and sucrose metabolism
    CLDAP_04910 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CLDAP_04910 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLDAP_04910 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CLDAP_04910 (glk)
Enzymes [BR:cap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLDAP_04910 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: BAL98530
UniProt: I0HZU3
Position
612437..613429
Genome map
AA seq 330 aa AA seqDB search
MLLAGDIGGTKTQLAIFSLAEGPRRPVAEAIFPSADYTNLADMVREFITQTNLPVEYACF
DVAGPVIGGRAQLTNLPWVIDSAALAAELNLQRVWLLNDLQATAYAVPQLTPGDLETLNK
GEPAEYGAIAVIAPGTGLGEAFLVWTGNSYMAYASEGGHTDFGPNNDVEIELLRFLLKRF
GHAGYERICSGIGIPNIYDFFRESGHFPESPEVAQALATAEDRTPIIVQAALDPVKPDPL
CVATMEMFVSVLGAEAGNLALKVLATGGVYLGGGIPPRILPFLQTERFMRAFTNKGRFSE
MISRIPVHIVLTQAALIGAARYGLERMSSH
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgctcttggcaggagacatcggaggaaccaaaacacaactggccatcttttcactggcg
gaagggccgcgtcgcccggtggcagaggcaattttccccagtgcagactatacgaatctg
gccgacatggtgcgcgagttcatcacacagaccaatttgcccgtcgaatacgcctgcttt
gatgtggcgggcccagtgatcggtgggcgggcgcagctcacgaacctgccctgggtcatc
gacagtgcagcgcttgccgcagagctcaacctgcagcgcgtctggctgctcaacgatctc
caggccaccgcttatgccgttccacagttgactccgggcgacctggagacactcaacaag
ggggaacctgccgagtacggcgccattgccgttatcgcaccgggcaccggtctgggcgaa
gcgtttctggtctggaccggcaactcctacatggcctatgcctcggaagggggccacact
gactttggccccaacaacgatgtcgagatcgaattgttgcgttttctgcttaagcgcttc
ggtcacgcaggctacgaacgtatttgttccggcatcggcattcccaacatctacgacttt
ttccgagagagcggtcacttccctgagtcgcctgaagtagcgcaggcgctggcgacggcg
gaagatcgcacgcctatcatcgtccaggcagcgctcgaccctgtgaaaccagacccgctg
tgcgtggcaacgatggaaatgttcgtaagcgtgctcggcgctgaggcgggcaacctggcg
cttaaagtgttagccaccggcggcgtctatctgggcggcggcattcctccgcgcatcctg
ccgtttctacaaacagaacgcttcatgcgtgcgttcaccaacaaaggacgcttttctgaa
atgatcagccggattcccgtgcatatcgtgttgacgcaggcagcgttgatcggggccgcc
cgctatggactggaacgcatgtcttcccactaa

DBGET integrated database retrieval system