KEGG   Caldilinea aerophila: CLDAP_06880Help
Entry
CLDAP_06880       CDS       T01797                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cap  Caldilinea aerophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CLDAP_06880 (malQ)
Enzymes [BR:cap01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CLDAP_06880 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
856167..857738
Genome map
AA seq 523 aa AA seqDB search
MLNVRRSGILLHPTSLPGAYGIGSFDQNAYYWVDFLAQTRQTLWQVLPLGPTGYGDSPYQ
SFSSFAGNPYLISLEHLVQLGLLEQQALDRAPTFPRARVDYGAIYTWKLPLLREVARNFQ
ARASADLRNEFETFCAENADWLEDFALFMALKDAHNGAPWNQWEMPLRSRQPKALDAARK
EHADAIVNHKLNQWFFYRQWLALKRSANEKGIFIIGDIPIFVAMDSSDAWCNPSEFFLDD
QYQPTVVAGVPPDYFSATGQLWGNPLYRWDVMKQNRYAWWIRRIRAALRLYDIVRIDHFR
GFAGYWEVPAREETAVNGRWVQGPGADFFHVIQAELGENLPIIAEDLGEITPDVIELRDR
FGLPGMKILQFAFSTDASDKFLPHNYTRNFVVYTGTHDNDTTWGWYRNTATDKERDYFRR
YFRTDGHDAAWTMIDGAFRSVANTAIVPLQDVLNLGGEARMNLPGRASGNWAWRFVPEQL
TGHVAERLLETTIIYGRDPKIYEGKAPESGGQTGQDQKGIGGG
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatgtgcggcgcagcggcatcctgctgcatcccacctcgttgcctggcgcatac
ggcatcggcagcttcgaccagaacgcctattactgggtggactttctggcgcagacacga
caaaccctctggcaggtgctgccccttggccctaccggctacggcgacagcccctatcaa
agcttcagctcctttgcgggcaatccctatctgatcagccttgagcatctggtacaactg
gggctgctggaacagcaggcgcttgatagggcgccgacctttccgcgcgcccgcgtcgat
tacggcgccatctatacgtggaaactgcccctgttgcgggaggtggcgcgcaattttcag
gctcgcgcctccgccgatctgcgcaacgaatttgaaaccttttgcgccgaaaacgccgat
tggctggaggactttgcgctctttatggcgctgaaagacgcccacaacggcgcgccgtgg
aatcagtgggaaatgccgctgcgcagccgtcagcccaaagcgctggacgcggcgcgcaag
gaacacgccgacgccatcgtcaaccacaagctcaatcagtggttcttctatcgccagtgg
ctggcgctcaagcgctctgccaatgagaagggcattttcattatcggcgatattccgatc
ttcgtggcgatggacagcagcgacgcctggtgcaatccttccgaattcttcctggatgac
cagtatcaacccacggttgtggcaggtgtgccgccggactatttcagcgccaccggccag
ttgtggggcaacccgctctaccgctgggacgtgatgaaacaaaaccgctatgcatggtgg
attcgccgcattcgcgctgccttgcgcctgtacgacatcgtacgcatcgatcacttccga
ggctttgccggctattgggaagtgcctgcacgcgaagagactgccgtcaacggacgttgg
gtgcaggggcccggcgccgatttcttccacgtcatccaggcggagctgggcgagaatctg
ccgatcatcgccgaagatctgggcgagatcacgccggatgtgatcgagctgcgcgaccga
ttcggcttgccgggcatgaaaattcttcagttcgctttcagcaccgacgccagcgacaag
ttcctgccccacaactacacgcgcaacttcgtcgtttataccggtacgcacgacaacgac
accacctggggctggtatcggaacacagcaaccgacaaggagcgtgactacttccgccgc
tacttccgcaccgacggccacgacgccgcctggacgatgattgacggcgccttccggagc
gtggcaaacacggcgatcgtgcccctccaggacgtgctgaacctgggcggcgaggcgcgc
atgaacctgcctggccgcgcctcgggcaactgggcgtggcgctttgtccccgagcagttg
accggtcatgtcgccgagcgactgctggaaacaacgatcatttacggccgtgatcccaaa
atttacgaggggaaagcccccgaatcaggtgggcagaccggccaggatcagaaaggtatc
ggcggcggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system