KEGG   Caldilinea aerophila: CLDAP_07080Help
Entry
CLDAP_07080       CDS       T01797                                 

Definition
putative glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cap  Caldilinea aerophila
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CLDAP_07080
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CLDAP_07080
Enzymes [BR:cap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CLDAP_07080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
879816..883016
Genome map
AA seq 1066 aa AA seqDB search
MRWRNSRKTRNWRGQWARWVATLWTIVILLTQTGVLQAQVATSTPTLTEESEAARLDRLA
AALVARMSPAERIGQLFVVTIQGRDVENNNEFIELFHRLHIGGVVLSPRYGNFSNERGVD
TPRQVATLTNQLQALAYGLVLPAEQALRPVPLAPWPPREDFTILPREKAPGAVPLPLLIG
VYQTGDDLPMTALRRGFTPLPSPMALGASWNRDLVRGVGSVVGRELRAVGFNLLLGPNLD
VFSLKNSNRLNALGVYSFGGDPYWVAQLGRAYIEGVHLGGGGRVATVADSFPGQGAADRV
PNEEVASIQLSRSELQQNALPPFLAVTRQPSTVIDPAGDPGATDILMTSHMRYIGLQGGD
GRGAPLSLAPELRTILRQEGVAEWQSRGGVIMSGPLGAPALRRYFETTNPDNFRRVAQDA
FVAGNDLLYLADLSLDGSWQSQFRNIVETISTFQSLYASDQDFAALVDEAARRVVRLKLG
LYRDSIDLIAAASALDAAETITQPVIPLSALLVTDTDISVLAGEERIAAEQQMGQIARSA
ITLLYPDPSTQTASVPPAFAPGDRILIFTDFRLQRECATCEQEPSVDPDALARIIERLYG
SQSAGVIDPNNIVSKTFVELSTLLDSLEQQRAVAAGETTPISAATATPTIAAGLLLTPTL
TPSASPPIPTQPAGSTATPDSLPQATSSPPVSLDEIENSTSVADLNSKTLEAIANADWII
FAMLDVAPESAPNSTAVKRLLSDHAGLLTNQKTVVLALHTPFYLDATEMSKLTAYFGVYS
KTTPFLESAIHALFRRYPPIGAPPVDVPGTRFASLAERLRPNPATQIPLQIEESDGDTLV
RTGQQSETDERPVIEAGALMRMRAGPVLDMNGHPVPDGILVNFDLRYEGEDVALMLEPAP
TRGGVAVREITLDRGGVLRVQARAEKATSRTVNIVVLPPATPTAVPGTSMNEGPSTEAQP
EDPSLIRSPAPDRVNLLTLAIALFTMTVVLSLLLILQVRVLPRSVLVHNMLWATIFGLTG
YILYGLGLFPGGGWLRSNIGMLSIPIVVFIPMLLPLLWLQLRSDGR
NT seq 3201 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggcgaaattctcgaaagaccagaaactggcgagggcaatgggcgcgctgggtt
gcgacgctttggacaatcgtcatcctgctcacccagacaggcgtcctgcaggcccaggtt
gccacgtcaacgccgacgctcacagaggagagcgaagccgcccggcttgaccggctggca
gcggcgctcgtcgcccgtatgtcgccggccgagcgtatcggccaactgttcgtggttacg
atccagggccgtgatgtagaaaacaacaacgagtttatcgagttgtttcaccggctacac
atcggcggcgtcgtgctcagcccacgttatggcaacttctccaacgaacggggcgtcgat
acgcctcggcaggttgccacgttgaccaatcaattgcaggcgctggcgtatggccttgtg
ttgcccgccgaacaagcgctgcgacccgtgccgttggccccatggcccccgcgcgaggac
tttacgatccttccgagggaaaaagcgccaggtgctgttccacttcctcttctgatcggc
gtctatcaaaccggcgacgacctgcctatgacagccttacggcgtggctttacgccgctg
ccctcgccgatggcgctgggggcgtcgtggaatcgagatctcgtacgcggcgtcggcagc
gttgtgggccgcgagctgcgtgccgttggtttcaatctgctcctggggcccaatctcgac
gttttttctctcaaaaactccaatcgacttaacgcgttgggagtgtattcgttcggaggc
gatccctactgggtagcgcagttaggacgcgcctacatcgaaggggtgcatctgggcggt
ggaggccgcgtcgccacggtcgccgacagttttccagggcaaggcgcagcggatcgcgtt
cccaacgaagaggtagcctcgattcagttgagtcgaagcgagctgcagcaaaacgccctg
cctccttttctcgccgtgacgcgccaaccctctaccgtgatcgacccggcgggcgatccc
ggcgccaccgacattctgatgaccagccacatgcggtacatcggcctgcagggcggcgat
ggccgtggcgctccgctgagcttagcgccggaactgcgcacgattttgcgacaggaaggc
gtcgccgagtggcaaagccgcggcggcgtcatcatgtctggccccctcggcgcgccggca
ctgcgtcgctatttcgagaccaccaatccagacaactttcgcagagttgcccaggatgca
ttcgtggccggcaacgacctgctctatctagccgacctgagcctggacggctcctggcag
tcccaattcagaaacatcgtggagaccatctctacgtttcaatctctttacgccagcgat
caggactttgctgcgctggtcgatgaagccgcccgccgcgttgttcgcctcaagcttggg
ctgtatcgtgattcaatcgacctgatcgcggcggcgagcgccctcgacgcggccgaaacc
atcacccagccggttattcctctctctgctcttctggtgacagataccgacatctccgta
ttagccggagaagaacgcatcgccgccgaacagcagatggggcagattgcccgttctgca
attacgctcctttatcctgacccttcgacacagacggcctcggtgccgcccgcctttgct
cctggcgatcgcattttgatttttaccgattttcgcttgcaacgggagtgtgccacctgt
gaacaggaaccgtcggtcgatcccgacgccctggcgcgcattatcgaacggctgtacggc
tctcagtcggcgggcgtgatcgatccgaacaacatcgtcagcaaaacattcgtcgagctg
agcacactgctcgacagcctggaacaacaacgtgcagttgcggcaggtgaaacgacgcca
atcagtgcagcgacagccacgcccactatagccgcaggcctgcttctcacgccgacgctc
accccttccgcctcgccaccgatcccgacacagcctgctggttcgacggcaacgcccgac
tcgctccctcaagcgacgtcttctccgcccgtgtcgctggacgagatcgagaattcaact
tctgttgcagatttgaacagcaagacgctggaggcgattgccaacgccgactggatcatc
ttcgccatgctcgatgtggcgccagagagcgcgccgaacagcactgcagtcaagcgcctc
ttgagcgatcacgcgggccttctcacgaatcagaaaacggtcgtgttggccctgcatacg
ccgttttatctggacgccacggaaatgagcaagttgaccgcttattttggagtctacagc
aagacgacgccatttctggaaagtgcaatccatgccctgtttcggcgctatccgccgatc
ggcgcgccgccggtcgatgtgccgggcacgcgatttgccagcctggccgaacgtctgcgg
cccaatccggccacgcagatccctctccagattgaggaaagtgacggggatacgctcgta
cgcaccggtcagcagtcagagacagacgaacgccccgtgatcgaggccggcgcgctgatg
cgaatgcgcgccgggcctgtgctggatatgaacggccatccggtccctgacggtatcctg
gtcaacttcgatctgcgctacgaaggtgaagacgtggcgttgatgttggaaccggcgcca
actcgcgggggcgtcgccgttcgagaaattacgctggatcgagggggcgtcttgcgcgtg
caggctcgcgccgaaaaggcaacaagccgcaccgtcaacatcgtcgttctgccgccggcc
acccctacggcagttccaggcacatcgatgaacgaaggcccctccaccgaggctcaaccc
gaagatccctcgctgatccgctcgccggcgcctgatcgggtcaatttacttacattagct
atagcactgttcaccatgacggttgtgctgagccttttgttgattctgcaggtacgcgtg
ctcccacgttcggtgttggttcacaacatgctctgggccacgatctttgggctgacaggg
tacattttgtacgggcttgggcttttcccaggtggcggctggctgcgcagcaacatagga
atgctgagcatccccatcgtcgtatttattccgatgttgctgcctttgctctggctgcaa
ttgcgcagcgacgggcgctga

DBGET integrated database retrieval system