KEGG   Caldilinea aerophila: CLDAP_08900Help
Entry
CLDAP_08900       CDS       T01797                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cap  Caldilinea aerophila
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cap00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cap00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1105410..1107059
Genome map
AA seq 549 aa AA seqDB search
MVTLYEVLNSLPEGEAIFSEATLDLVIEDVTADSRQVRPGSLFVAVPGGRNDGHRFIGAA
IAHGAVAVIGERPLSEIEAEASGIGRTVPYLRVGNSRRALAFACAALHAFPSRHLAIVGV
TGTDGKTTTSSILESILRAATATKDAPAGEVGVITTVGARIRGEEIDTGLHVTTPDAPEV
QRFLRAMVDAGCRYAVVESTSHGLHQQRVAAVDFDVAAVTNITHEHLDYHGSREAYVAAK
ALLFRALFASPPKPGVPRAAVLNADDPGSYDALRTVLAEEKMRSGFDIPVRSYGIAGRSQ
MPLDVAVEHIAYDADATRFDLRWWGGCFSIDSPLIGEFNVYNVACAATAALALGIDPSAI
QRGVKTMPPVLGRMQRIDAGQPFLAIVDFAHTPVSLERALTTLRPLVGRGGQDGRLIAIF
GSAGLRDREKRYLMGRISGRLADYTIITAEDPRTEDLGEICREIERGVREFAGADRYAII
YDRSEAIQAGVDMAQPGDVVVAFGKGHERSMCFGEIEYPWSDQEAMRTALQLRAQREAAA
PPGRDPEPS
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggtcactttatacgaagtgctgaacagtttgcctgaaggcgaagcgattttttccgaa
gcgaccctcgaccttgtgattgaagatgtcaccgcagatagccgccaggtgcgtcctggt
tcactcttcgtggctgtgccgggcggccgcaacgacggccaccgcttcatcggcgcagcc
atcgcgcacggcgctgtggcggtgatcggtgaacgtccgctttcagaaattgaggctgaa
gcaagcggcatagggcgcacagttccttacctgcgcgtcgggaacagccgccgcgcgttg
gcgtttgcctgtgcagcattgcatgcgtttccgagccgccatcttgccatcgtcggcgtc
accggaaccgacggcaagacgacgacctcctccattttggagtcgatcctgcgcgcagcg
acggccacgaaggatgcgcccgccggtgaggtcggcgtcatcacaaccgtcggtgcacgc
attcgaggggaagagatcgacaccggtctgcatgtcaccacgccggacgcaccggaggtg
cagcgttttttgcgcgccatggtggacgctggctgtcggtacgccgtcgttgaaagcacg
agccacggcctgcatcagcagcgcgtggcggccgtagactttgacgtggcagcggtgacg
aacatcacccacgaacatctcgattatcacggctcgcgtgaggcgtacgtggcggctaag
gcgctgttgtttcgtgcgctctttgcttctcctcccaaaccgggcgtcccccgtgcggcg
gtactcaacgccgacgatccaggcagttacgatgccctgcgcaccgtgcttgccgaggag
aaaatgcgcagcggcttcgatatccctgttcgcagctatggaatcgctggccgttcgcag
atgcctctggatgtggctgtggaacatatcgcctatgacgccgacgccacgcgcttcgat
ctacgatggtggggcggctgcttttcgatcgactcgccgctgatcggcgaattcaacgtc
tacaacgtagcctgcgcggcaactgctgcgctggcgttggggatcgatccgtcggcgatt
caacgtggggtgaagacgatgccgcccgtcctggggcgaatgcaacgcatcgatgccgga
cagcctttcctggcaattgtcgattttgcacacacgccggtcagcctggagcgcgcgctg
accacgctacggccgctcgtcggacgcggcggacaggacggcagattgatcgctatcttt
ggctcggcggggctgcgcgaccgcgagaagcgctatttaatggggcggatcagcggccga
ttggcggattatacgatcatcacagcggaggatccgcgcaccgaagacctgggcgagatc
tgtcgggagatcgagcggggggtgcgcgagttcgccggggccgaccggtacgccatcatc
tatgatcgcagcgaggccatccaggccggcgtagacatggcgcagccaggcgacgtcgtg
gtcgctttcggcaaaggacacgaacgtagcatgtgcttcggagagatcgaatatccatgg
agcgatcaggaagcgatgcgaacggcgttgcagcttcgcgcgcagcgggaagctgcagcg
cctcctggaagagacccagaaccatcatag

DBGET integrated database retrieval system