KEGG   Caldilinea aerophila: CLDAP_08900Help
Entry
CLDAP_08900       CDS       T01797                                 

Gene name
murE
Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cap  Caldilinea aerophila
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CLDAP_08900 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CLDAP_08900 (murE)
Enzymes [BR:cap01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     CLDAP_08900 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1105410..1107059
Genome map
AA seq 549 aa AA seqDB search
MVTLYEVLNSLPEGEAIFSEATLDLVIEDVTADSRQVRPGSLFVAVPGGRNDGHRFIGAA
IAHGAVAVIGERPLSEIEAEASGIGRTVPYLRVGNSRRALAFACAALHAFPSRHLAIVGV
TGTDGKTTTSSILESILRAATATKDAPAGEVGVITTVGARIRGEEIDTGLHVTTPDAPEV
QRFLRAMVDAGCRYAVVESTSHGLHQQRVAAVDFDVAAVTNITHEHLDYHGSREAYVAAK
ALLFRALFASPPKPGVPRAAVLNADDPGSYDALRTVLAEEKMRSGFDIPVRSYGIAGRSQ
MPLDVAVEHIAYDADATRFDLRWWGGCFSIDSPLIGEFNVYNVACAATAALALGIDPSAI
QRGVKTMPPVLGRMQRIDAGQPFLAIVDFAHTPVSLERALTTLRPLVGRGGQDGRLIAIF
GSAGLRDREKRYLMGRISGRLADYTIITAEDPRTEDLGEICREIERGVREFAGADRYAII
YDRSEAIQAGVDMAQPGDVVVAFGKGHERSMCFGEIEYPWSDQEAMRTALQLRAQREAAA
PPGRDPEPS
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggtcactttatacgaagtgctgaacagtttgcctgaaggcgaagcgattttttccgaa
gcgaccctcgaccttgtgattgaagatgtcaccgcagatagccgccaggtgcgtcctggt
tcactcttcgtggctgtgccgggcggccgcaacgacggccaccgcttcatcggcgcagcc
atcgcgcacggcgctgtggcggtgatcggtgaacgtccgctttcagaaattgaggctgaa
gcaagcggcatagggcgcacagttccttacctgcgcgtcgggaacagccgccgcgcgttg
gcgtttgcctgtgcagcattgcatgcgtttccgagccgccatcttgccatcgtcggcgtc
accggaaccgacggcaagacgacgacctcctccattttggagtcgatcctgcgcgcagcg
acggccacgaaggatgcgcccgccggtgaggtcggcgtcatcacaaccgtcggtgcacgc
attcgaggggaagagatcgacaccggtctgcatgtcaccacgccggacgcaccggaggtg
cagcgttttttgcgcgccatggtggacgctggctgtcggtacgccgtcgttgaaagcacg
agccacggcctgcatcagcagcgcgtggcggccgtagactttgacgtggcagcggtgacg
aacatcacccacgaacatctcgattatcacggctcgcgtgaggcgtacgtggcggctaag
gcgctgttgtttcgtgcgctctttgcttctcctcccaaaccgggcgtcccccgtgcggcg
gtactcaacgccgacgatccaggcagttacgatgccctgcgcaccgtgcttgccgaggag
aaaatgcgcagcggcttcgatatccctgttcgcagctatggaatcgctggccgttcgcag
atgcctctggatgtggctgtggaacatatcgcctatgacgccgacgccacgcgcttcgat
ctacgatggtggggcggctgcttttcgatcgactcgccgctgatcggcgaattcaacgtc
tacaacgtagcctgcgcggcaactgctgcgctggcgttggggatcgatccgtcggcgatt
caacgtggggtgaagacgatgccgcccgtcctggggcgaatgcaacgcatcgatgccgga
cagcctttcctggcaattgtcgattttgcacacacgccggtcagcctggagcgcgcgctg
accacgctacggccgctcgtcggacgcggcggacaggacggcagattgatcgctatcttt
ggctcggcggggctgcgcgaccgcgagaagcgctatttaatggggcggatcagcggccga
ttggcggattatacgatcatcacagcggaggatccgcgcaccgaagacctgggcgagatc
tgtcgggagatcgagcggggggtgcgcgagttcgccggggccgaccggtacgccatcatc
tatgatcgcagcgaggccatccaggccggcgtagacatggcgcagccaggcgacgtcgtg
gtcgctttcggcaaaggacacgaacgtagcatgtgcttcggagagatcgaatatccatgg
agcgatcaggaagcgatgcgaacggcgttgcagcttcgcgcgcagcgggaagctgcagcg
cctcctggaagagacccagaaccatcatag

DBGET integrated database retrieval system