KEGG   Caldilinea aerophila: CLDAP_08940Help
Entry
CLDAP_08940       CDS       T01797                                 

Definition
putative alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
cap  Caldilinea aerophila
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CLDAP_08940
  Lipid metabolism
   00561 Glycerolipid metabolism
    CLDAP_08940
   00600 Sphingolipid metabolism
    CLDAP_08940
Enzymes [BR:cap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CLDAP_08940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1109862..1111247
Genome map
AA seq 461 aa AA seqDB search
MTKISFLGAGSTVFAKNLIGDILSYPELQDATISLFDIDPERLRTSEIVAHKIADYFGIS
PRIEATTDRRQSLKDADFAISMFQIGGYKPATVIDFEIPKKYGLRQTIADTLGIGGIMRG
LRTIPVFLDIACDMEELCPDAVLLQYVNPMAMNCWALSRATGVKTVGLCHSVQGTAEQLA
HDIGVPIEEINYLCAGINHMAFYLRFERNGEDLYPLIRRVIEEGRVPDWNRVRYEVFKRV
GYFVTESSEHFAEYVPWFIKRDRPDLIETFNIPLDEYIRRCEVQITGWEFMRRKLENPEL
DLSKEFAEAMAKAGVSPEHLPLVVHHFERLNEVERSHEYGSLIVHSIVTGQPRVIYGNVP
NYGLIDNLPQGCCVEVPCLVDKNGVQPTRIGTLPPHLAALMRTNINVQEMVVEAALTLKR
EYIYYAAMLDPHTAAELDLDQIWHLVDDLIEAHGNWLPKYH
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaatcagctttctgggtgcaggcagcactgtctttgctaaaaacctcatcggc
gacatcctgagttatccagagttacaggacgccacgatcagcctctttgacatcgatccg
gagcgtctgcgcacctccgaaatcgttgcccacaagatcgcagactatttcggcatttcg
cctcgcatcgaggcgacgaccgaccgcagacagtcgctcaaagacgccgacttcgccatc
agcatgttccaaattggcggttacaagcctgccacggtgatcgactttgagattccgaag
aagtacggactgcggcagaccatcgccgatacactgggcatcggcgggattatgcgcggc
ctgcgcacgattcccgtttttctcgatattgcttgcgatatggaggagctctgcccggat
gcagtgctgctgcaatacgtcaatccgatggcgatgaattgctgggccttgagccgcgcc
actggtgtgaaaacagttggcctgtgtcacagcgtgcagggaactgccgagcaactggcc
catgacattggcgttccgattgaggagatcaactatctgtgtgcaggcatcaaccacatg
gccttctacctccgtttcgagcgcaacggtgaggatctctatccgttgatccgcagggtg
atcgaggaaggccgcgtgcccgactggaatcgcgtgcgctacgaggtcttcaaacgcgtc
ggctactttgtcacagagtcgagcgagcatttcgctgagtatgtgccctggttcatcaag
cgtgatcgtccagacctgatcgaaacattcaacattccgcttgacgagtacatccgccgt
tgcgaggtgcagatcacgggctgggagttcatgcgacgcaagctggagaacccagagctt
gacctgtcgaaggagttcgctgaagcgatggccaaagcgggtgtctcgccggagcatctg
ccgctggtcgtgcatcactttgaacgactcaacgaagtggagcgtagccacgagtacggc
tcgctgatcgtgcacagcatcgtcaccggccaaccgcgcgtgatctacggcaacgtgccc
aactacggcctgatcgacaacttaccacagggttgctgcgtggaggtgccttgcctggtc
gacaagaacggcgtgcagcctacccggatcggcacgttgccgccccacctggccgcctta
atgcgcacgaacatcaacgtgcaggagatggttgtcgaagctgcgctcacgctcaagcga
gagtatatctactacgctgccatgcttgacccacacacggcggccgaactcgatctcgat
cagatctggcatttggttgacgatctgattgaggcgcacggcaattggctaccgaaatat
cactga

DBGET integrated database retrieval system