KEGG   Caldilinea aerophila: CLDAP_09830Help
Entry
CLDAP_09830       CDS       T01797                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cap  Caldilinea aerophila
Brite
Enzymes [BR:cap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CLDAP_09830
Transfer RNA biogenesis [BR:cap03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CLDAP_09830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1223817..1225622)
Genome map
AA seq 601 aa AA seqDB search
MLGCWLQPEWIFSPEGTDYPNKLDYTATEIAMKRVLSPEEIPADVIEKAEAWQARRRNFD
PAREAATLYTIFQAVRAVPESEWDERNSLQRILLRYPKQNRELYSKANLVAGYRHLVAEG
DIEADPVLEKRIRMKPMRTQSGVAPVTVLTAPAGCPGKCIFCPDDWRMPKSYIYDEPGCQ
RAERDGFDPFKQTLGRIQSFESIGHDASKVELLILGGTWSAYSRDYREWFVQRCFDAMNA
AGDPSLATSASLAEAQERNVTARHRNVGLVVETRPDWITPEEIVHLRKLGVTKVQIGVQS
LDDNILALNKRGHDVEAVRRALGLLRTAGFKLHLHWMPNLYGATPETDRADFARLFSDPA
IRPDELKIYPCSLIAGTELYERYLAGEYRPYSEEELVALLADVKPTIPPYTRVNRLFRDI
PAHHIQAGVKLSNLRQIVQEELVRRGQRCGCIRCHEIRRREVRLDQLELRVYSYATDLTQ
EHFLHFVTNQSHPEPGLIAGFLRLSLPNHERVGSRAFLPEIAGHAMIREVHVYGPALRIG
AESNGQPQHAGLGTQLIEAARRISREAGFRRISVIAATGTQAYYAARGFERGELYMSGDT
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
ttgctgggctgctggctgcagccagagtggattttctcgccggagggcactgactatccg
aataagttggattatacggcaacagagatcgccatgaaacgagtgctttcaccggaagag
attccggctgacgtgatcgaaaaggcggaggcctggcaggctcgacgccgcaactttgac
ccggcgcgcgaggcggccacgctctacaccatctttcaagcggtgcgcgctgtcccggaa
agcgagtgggacgaacgtaacagcctgcagcgcatcttgctgcgctatcccaaacaaaac
cgggagctgtactccaaggccaaccttgtcgctggctaccgtcatctggtggcggaagga
gacatcgaagctgatcccgtgctcgaaaagcgcatccgcatgaaaccgatgcgcacacag
agcggtgtggcgcctgtgaccgtcctgacggcgcctgcgggctgtcccggcaaatgcatc
ttctgcccggacgattggcgcatgcccaaaagctacatctacgacgaaccaggctgtcaa
cgtgccgaacgcgacggcttcgaccccttcaagcagacgctgggacgcatccaatccttt
gagagcatcggccatgacgccagcaaagtggagctgttgatcctcggcggcacatggagc
gcctatagccgagattaccgggagtggtttgtgcagcgctgctttgacgccatgaacgct
gccggtgatccgtcgctggcaacctccgcctcccttgccgaagcacaggagcgcaacgtc
accgcccgccaccgcaacgtcggcctggtggtcgagacgcgaccggactggatcacgccg
gaggagatcgttcatctgcgcaaactgggtgtgaccaaggtgcagatcggcgtgcagagc
ctggatgacaacattctggcgctgaacaagcgggggcatgatgtagaggccgtgcgtcgc
gccctggggctgctgcgtaccgccggcttcaagctgcacctgcactggatgcccaatctc
tatggagctacgcctgaaacagatcgcgccgacttcgcccgcctgttcagtgacccggcc
attcgccccgatgaactgaaaatctacccatgttcgctcatcgccggcaccgagctgtat
gaacgctacctggccggggaatatcgtccctatagcgaagaggagttggtcgccttgctg
gcggacgtcaagccgaccattccaccctacacgcgcgtcaatcgccttttccgcgacatt
ccggcgcatcacatccaggcgggcgtcaagctgagcaacctgcgccaaatcgtacaggaa
gaattggtgcggcgcggtcagcgctgcggctgcattcgctgccatgaaatccgccgtcgt
gaggtgcggctcgatcagcttgagctgcgcgtgtacagctacgccaccgacctcacccag
gagcacttcctgcactttgtcaccaatcaaagccaccctgagccgggtctcatcgccggc
tttttacggctgagcctgcccaatcacgagcgggtcggcagccgcgccttcctccctgaa
attgccggccatgcgatgatccgggaagtgcacgtctatggcccggcgctgcgcatcggt
gcagaaagcaacggccaaccgcagcacgctggcctgggcacgcaactgatcgaggcggct
cgccgcatcagccgggaggcgggcttccgccgcatcagtgtgattgcggctacaggcacg
caggcatactacgctgcgcggggcttcgagcggggcgagctgtacatgtccggcgacacg
gcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system