KEGG   Caldilinea aerophila: CLDAP_09870Help
Entry
CLDAP_09870       CDS       T01797                                 

Definition
putative sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
cap  Caldilinea aerophila
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CLDAP_09870
Enzymes [BR:cap01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     CLDAP_09870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1229164..1230954)
Genome map
AA seq 596 aa AA seqDB search
MSTTVERLRASLASVYGSATAGEILERLLPRIEEVRAKRVTSPHTDASSMSQQTQSMRTL
PDQREVILITYGDQIQEEGKPPLRTLCEVLESTVSDVCSGVHILPFYPYTSDDGFSVVDY
RQVDPALGDWEEIRRLGRRFRLMFDAVINHISASSPWFQAFLRGEAPYTEYFITVDPSVD
LSSVVRPRTSPLLTPFATVDGVKYVWTTFSADQVDLNYRSPVLLYEILDLLLFYVEQGAQ
RIRLDAVGFLWKEIGTSCIHLPQTHALIQAMRAMLDLAAPDVLLITETNVPHLENISYFG
DGYNEAQMVYNFTLPPLTLYTFHKQDATLLSEWAASLSTPSEQTTFFNFMASHDGIGVRP
LEGVLRREEIDALVERTLRHGGLVSYRAAPDGSQVPYELNIVYFDALNDPNADEPLALQV
DRFLASQAILLGLAGVPGIYVHSLFGSRNWREGVTLTGQNRTINRRKFRRNELETLLNDP
TSLPHQVFTRYHRLIATRTGEPAFHPNAPQQIVHIDPAIFAFVRTRLDSSRRVLCLHNVA
DHEIQIRIDVSALGLRPGKRLVDLISGRELSLYGAQLEMSLPPYGVYWLGDEIGMA
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgacggttgagcgactgcgcgccagccttgcttcggtctacggcagcgccacc
gccggagaaattcttgaaagattgcttcctcgcattgaagaggtgcgcgcaaaacgcgtc
acaagtccccacaccgatgcctccagtatgtcgcagcaaacacaatccatgcgtacctta
cccgatcagcgagaggtcattctgatcacctacggcgatcagattcaggaggaagggaag
ccaccgctgcgcacgctctgcgaggtgttggagtcaacggtaagcgatgtgtgtagcggc
gtgcatatcttacctttctatccgtacacctccgacgatggtttttctgtggtcgattat
cgacaggttgacccagccttgggcgattgggaggagattcgtcgcctgggccggcgcttt
cgcctgatgttcgacgccgtgatcaaccacatttcggcctccagcccctggtttcaggca
tttctgcgtggagaagcgccctacacggagtacttcatcaccgtggatccttctgtcgat
ctctcatcggtggtgcggccgcgcacgtcccctctactgacgccgttcgcaacggttgac
ggcgtcaaatatgtatggacgacctttagcgcagatcaagttgacctcaactaccgctcg
cctgtgctcctttatgaaattctcgacctgcttcttttctatgtggagcagggcgcgcaa
cggatccgactggacgcagtcggctttctgtggaaggaaattggaacgtcgtgcatccac
ctgccacagacccatgcactgatccaggcgatgcgcgccatgctcgacctggccgcgccc
gacgtcctgctcatcaccgaaaccaacgtgccacacctggagaacatcagctacttcggt
gacggctacaacgaggcacagatggtctacaacttcaccctgccgccgctcacgctgtac
acctttcacaagcaggacgccacgctgctctcagagtgggcagcgagcctttcgacacct
tccgagcagacgactttcttcaacttcatggcctcgcacgacggcatcggcgtgcgcccg
ttggaaggtgtcctgcgccgagaagagatcgatgcgttggtcgaacgcacgctcaggcat
ggcgggctggtcagctatcgcgcggcgcccgacggcagccaggttccctatgagctgaac
atcgtctatttcgacgcactcaacgatccgaatgcagacgaaccgctggcgttacaggtc
gatcgatttttggccagtcaggccatcctgctcggtttagccggcgtgcccggcatctat
gtgcatagcctcttcggcagccgcaactggcgcgagggggtgaccttaaccggacaaaac
cgcaccatcaaccgccgtaaattccgccgcaacgaattagagacactgctcaacgatccg
acttcgctgccgcatcaggtcttcacacgctatcaccgcctgatcgctacgcgcactggc
gagccagcctttcatcctaatgcgccccaacagatcgtccacatcgacccggcaatcttc
gcgtttgtgcgcacccgcctggatagcagtcgccgcgtgctctgcctgcataatgtggcc
gatcacgagattcagattcgcatcgacgtgagcgcgttagggctgagaccgggcaaacgt
ctcgtcgacctgatcagcggcagagaactctcgttgtacggcgcacaattggagatgagc
cttccaccctacggcgtctattggctaggcgatgagatcggaatggcctga

DBGET integrated database retrieval system