KEGG   Caldilinea aerophila: CLDAP_10020Help
Entry
CLDAP_10020       CDS       T01797                                 

Gene name
aceB
Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
cap  Caldilinea aerophila
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLDAP_10020 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CLDAP_10020 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    CLDAP_10020 (aceB)
Enzymes [BR:cap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     CLDAP_10020 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1247776..1249305)
Genome map
AA seq 509 aa AA seqDB search
MIEVLTPDALAFVATLHRHFNPRRIELLAARKERQKRFDAGEMPGFLPETASIRTAWWRV
APAPEDLNDRRVEITGPSERKMMINALNSGAKVFMADFEDALSPTWSNVIHGQINCSDAI
RRTISFESPEGKRYTLNEEVATLVVRPRGWHLVEKHVLIDGEPISASLFDFGLYMFRNAK
ELLARGSGPYFYLPKLESHLEARLWNDVFNAAQDALGIPRGSIRATVLIETILAALEMEE
ILYELREHGAGLNAGRWDYIFSVIKKFAKNKHLVLPDRAQVTMTVPFMRAYTELLIRTCH
KHDAHAIGGMAAFIPNRRDPVVTENALKKVREDKLREFGDGCDGTWVAHPDLVPTVLEVA
NSYLGNKPHQKDRKREDVHVQDSELTNIMVPGGTITEEGLRLNISVALQYLNAWLLGNGA
AAINNLMEDAATAEISRSQIWQWIHHGAALADGRPVTRELYAQIRDEELAKLGGTSVGRY
KDAVEILDTLCLSEEFIEFLTLIAYNYLD
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaagtattaaccccggatgcgctcgcctttgtcgcaaccctgcaccgccatttc
aatccgcgacgcatcgagctccttgcagcgcgcaaagaacgccagaaacgtttcgacgca
ggggagatgcccggttttttgccggagactgcgtcgatccgcaccgcctggtggcgggtg
gcacctgcgcccgaagacctcaacgatcgtcgcgtcgagatcaccggccctagcgagcgc
aaaatgatgatcaacgccctgaactccggcgccaaagtcttcatggccgatttcgaggac
gccctttcgccgacatggagcaacgtcatccacgggcagatcaactgcagcgacgccatc
cggcgcaccatttcctttgagagcccagaaggcaaacggtacacgctgaacgaggaggtg
gcgacgctggttgtgcgcccgcggggctggcacctggtggagaaacatgtcctcatcgac
ggcgagccgatctcagccagcctcttcgattttggcctttacatgttccgcaacgcaaaa
gagttgctggcgcgaggcagcggtccctatttctatttgcccaagctggagagtcatctt
gaggcgcggttgtggaatgacgtcttcaacgcagcacaggatgcactgggcattccgcgc
ggctcgatccgcgccaccgtgctgatcgaaaccatcctcgctgcgctggagatggaagaa
attctctatgaactgcgcgaacatggcgctggcctcaacgccggacgatgggactatatc
ttcagcgtgattaaaaagttcgccaaaaacaagcacctggtcctgcccgaccgtgcccag
gtgacgatgaccgtgcccttcatgcgcgcctacaccgagctgctgattcgcacctgtcat
aagcacgacgcacacgctatcggtgggatggctgccttcattcccaaccgccgcgatccg
gtggtgaccgaaaatgcgctcaaaaaggtgcgcgaggacaaactgcgcgaattcggcgac
ggctgcgacggcacctgggtagcccaccctgacctggtgccgactgtgttggaggtggcc
aacagttacctgggaaataagccgcaccagaaagatcgcaagcgagaggatgtccacgtc
caggatagcgaactgacgaacatcatggttcctggcggtacaatcacggaggaggggttg
cgcctcaacatcagtgtggccttgcaatatctgaacgcctggctgctgggcaacggtgca
gcggctatcaacaacctgatggaggatgcagccaccgccgaaatctctcgctctcagatc
tggcaatggattcatcacggtgcagcgctggcggatggccggccggtgaccagggaatta
tacgcccagatacgcgacgaagagctggcgaagctgggcgggacttccgtgggccgctac
aaagacgccgtcgagattctggacacgctctgcctgagtgaagagtttatcgagtttttg
accttgattgcgtacaactatctggactga

DBGET integrated database retrieval system