KEGG   Caldilinea aerophila: CLDAP_10810Help
Entry
CLDAP_10810       CDS       T01797                                 

Definition
putative cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cap  Caldilinea aerophila
Brite
Enzymes [BR:cap01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CLDAP_10810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1358289..1359560
Genome map
AA seq 423 aa AA seqDB search
MRLGAARSERLFLLAVSGVMALLLGVGAVVFLTDSPTWSPDEVALLRSLSLDALEPLPPD
PSNRVANNPGAIALGERLFFDARFSANGAVSCASCHMPERYFTDGRPFGVGVGVIPLNTM
TLIGAAYSPWFTWDGKADSQWAQALLPLENAVEHGGNRTLYAHLIAEHYAAEYEALFGTL
PDLSHLPRNAGPVDDPVAAAAWEAMTPEEQDAINRIFANIGKALAAFQRTLLPQPARFDR
YVASLNDDGRSSQPGILSEEEIAGLRLFIGKGQCINCHNGPRFTNDAFHNTGVPAAPGYP
VHRGRIDGVARVQSDLFNCLGPYSDAAPEECTALRFIVTEGDTLPGGMKTPTLRNVAETA
PYMHTGQFATLADVIEHYNAGGGLALIGHNELHQPLNLTATEAKQLEAFLRTLTEEPMPT
EEP
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcggcgcagcccggagcgaacgcctgtttttactggcggtcagtggtgtcatg
gcgctcctgttgggggtcggcgctgttgtgtttttgaccgattctccaacctggagccct
gacgaggtggcgctgcttcgcagcctctcactcgatgccctggagccgctgccccctgat
ccctccaaccgtgtggccaacaatccaggcgccattgcgctgggcgagcgcctctttttc
gacgcgcgtttcagtgccaatggtgctgtgtcgtgtgcctcctgccacatgccagagcgc
tatttcaccgacggtcgtcctttcggcgtcggtgtcggtgtgattccgctcaacaccatg
acgctgatcggcgcagcatacagcccctggttcacatgggacggcaaggccgacagccag
tgggcgcaagcgctgctgccgctggaaaacgctgtcgaacacggcggcaaccgcacccta
tatgcccatctcatcgccgaacattacgcggcggaatatgaggcactcttcggtacgctg
cctgacctgagccatcttccgcgcaacgccggccctgtcgatgaccctgtcgctgcggca
gcctgggaggcgatgacgccggaggagcaagatgccatcaaccgcatttttgcgaatata
ggcaaagcgctggctgcgtttcagcgcacgttactgcctcagccagcacgtttcgatcgt
tacgtcgcttctctcaacgatgatggacgctcctctcagcctggcatcctgagcgaggaa
gagattgccgggctgcgcctttttatcggcaaggggcagtgcatcaactgccataatggc
ccacgcttcacgaacgacgcctttcacaacacaggcgtgcccgctgcgcccggctatccg
gtgcaccgtggacgcatcgacggcgtcgctcgcgtccagtcggacctgttcaactgcctg
gggccctacagcgacgcggcaccggaggagtgcacggcgctgcgatttatcgtaacagag
ggggatacgctgcccgggggcatgaaaacccccacgttacgcaacgtggctgaaaccgca
ccctacatgcacaccggccaattcgccacgctggctgacgtgatcgagcactacaacgct
ggcggtggtctggcgttgatcggccacaatgagcttcatcagccgcttaacctcaccgca
acagaagcgaaacagctcgaagcctttctccgcacgctgacagaggaacccatgcccaca
gaggaaccttga

DBGET integrated database retrieval system