KEGG   Caldilinea aerophila: CLDAP_12260Help
Entry
CLDAP_12260       CDS       T01797                                 

Definition
putative beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
cap  Caldilinea aerophila
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CLDAP_12260
Enzymes [BR:cap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CLDAP_12260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1549775..1551841)
Genome map
AA seq 688 aa AA seqDB search
MFRFGVDYYPEHWPEERWAIDARLMQEAGFNTVRLAEFAWSRMEPAPGRFDFDWLDRAIA
ILQEHGIQVILGTPTASPPPWVMAMHPDAHRVLPSGLRVAYGNRRNYCPTHAGYRERGRI
ITQAMAEHYAHHPAVIGWQIDNEFGDRCYCEQCRAAFHAWLQRKYPSLDALNEAWGTVFW
SHVYTEWSQIPVPLETAAPFGDGSHNPGLALDYYRFMSDQYVAFQREQIEILRRWCPHHF
ITHNMMGAGYDRLNYFDLAADLDFVSWDNYRRMQWTFHPEVRPSEAALSHAVMRGLKQKN
FWVMEQQAGAGGWQIVSVAPRPGELRLWAYQSIAHGADAIIFFRWRTARFGTEQYWHGLL
EHDGRPGRRYAEIKQMGAEIARVGADLAGSEVRADVAILLDYDSRFAFQIQANNPAFQYT
SHLHDIYQAFHRWNVVVDIVSGNDDFSRYKLLIVPALYVLPEETARRIERFVRNGGVLMV
TPRTGVKDATNTVVNMPLPGLLAGVCGVEVEEYDSLPEGVSQPLTFMTEDFQNGPAPHAR
IWCDVLRVHGAQPIALYTQDYYAGKPAITENIYGAGRAVYVGTFGDGELYNALVEGLLKR
AHIQVEMSTPAGVEWSVRWQGERPIHFVLNHTSQKQQVNLKRRMQDLLTGNALESGTVEL
PPYQVLILAAQSTEDETSVEKPASVYEG
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgatttggcgtggattactatccggagcactggccagaggaacgttgggcaatc
gatgcccgcctgatgcaagaggccggtttcaacacggtgcgtctggccgaattcgcctgg
agccggatggagcctgctccgggccgctttgactttgactggctcgatcgggctatcgcc
atcttgcaggaacacggcattcaggtcattttgggtacgcccactgcatcgccgcccccc
tgggtgatggcgatgcacccggatgcacaccgtgtcctgccctcgggtctacgtgtcgcc
tatggcaaccgccgcaactattgccccacccatgcagggtatcgcgaacggggtcggatc
atcacgcaggcgatggcggagcactacgcccatcatccagcggttatcggctggcagatc
gacaacgagtttggcgatcggtgctactgcgaacagtgccgggctgcgtttcatgcctgg
ctccagcgcaagtatcccagcctggacgcgctcaacgaagcgtgggggacggtgttctgg
agccatgtctatacggagtggtctcagatccctgttcccctggagaccgctgcgccgttc
ggcgatggctcgcacaaccctgggctggcgctcgattattaccggttcatgtccgatcag
tacgtggcatttcagcgcgagcagatcgaaattttacgccgttggtgcccccaccacttt
atcacccacaacatgatgggggcggggtatgaccgtctcaactactttgaccttgcagcc
gatctcgacttcgtgagctgggacaactatcgacgcatgcaatggacgttccaccctgag
gtcaggccgagcgaagccgcgctctctcacgccgtcatgcgtggattgaaacagaaaaat
ttctgggtgatggagcagcaggcgggcgcaggcggctggcagatcgtcagcgtggcgccg
cggccgggcgagctacgcctgtgggcctaccagtcgatcgcgcacggagccgatgccatc
atctttttccgctggcgcactgcccgctttggcacggagcaatactggcacggcctgctt
gagcacgacggacgcccgggccgacgctatgctgagatcaagcagatgggagccgagatc
gctcgcgtcggcgccgatctggcaggcagtgaagtacgggcggatgtcgccattctgctc
gattacgatagccgctttgcttttcagattcaggccaacaatccggcttttcaatacacg
agccatcttcatgacatctatcaggcgtttcacagatggaatgttgtggttgacatcgtt
tccggcaacgatgacttcagccgctacaagttgctgattgtgccggcgctttacgtgttg
ccggaagagacggctcgccgcatcgagaggtttgtgcgcaacggtggcgtcctgatggtg
acgcctcggactggcgtcaaagacgcaaccaacactgtcgtcaatatgccgttgccgggt
ttactggcgggcgtgtgcggcgtcgaagtggaagagtacgattcattgccggaaggcgtc
agccagcccttgactttcatgacagaggattttcagaacgggccagcgccccatgcccga
atctggtgcgatgtgttgcgcgtgcacggcgcccaacccattgccctgtacacgcaggac
tactacgcaggcaagccggccatcacggagaacatttacggcgcaggcagggcagtgtac
gtgggaacgttcggcgacggtgaactgtacaacgcactggtcgaagggctgttgaagcgg
gcgcatatccaggtcgagatgagcaccccggcgggcgtggaatggagcgtgcgctggcag
ggcgagcgtccgattcacttcgtgctcaaccatacgtcgcagaaacaacaggtgaatctg
aaacgccgaatgcaggacttgctgaccggcaacgcgctggagtcgggcactgtggagctc
ccgccttatcaggtgttgatcctggcagcacagtctacagaggacgaaacttctgtggaa
aagcctgcaagcgtttacgagggctag

  All links  
No link information was found.   
DBGET integrated database retrieval system