KEGG   Caldilinea aerophila: CLDAP_14200Help
Entry
CLDAP_14200       CDS       T01797                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cap  Caldilinea aerophila
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cap00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1785436..1786341
Genome map
AA seq 301 aa AA seqDB search
MTTPNNFLGLDAEYSDFARAGVLVLPLPFEATVSYGHGTAGGPEAILTASQQVELYDREY
DDEPALRYGVHTLPALALPDDPAAAVTAIRAATAEAACSGKFLVALGGEHTVSVGVGLGL
LDALGGPLTVVQIDAHSDLRDQYEGTPYSHACIARRLLESPHIEQVLQLGIRSVCTEEVA
FARSHPDRVGIWYAEAVHDGSWRRAFIERVKGRRVFLTIDVDGLDPSIVPATGTPEPDGL
TWRETLDILHTLNEHAEVIGMDCVELAPSPGLHMADFAVAKLVYKAISYTMMRPATGMHS
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgccaaacaattttctggggctggatgccgaatacagcgactttgcgcgcgca
ggcgtcctggtgttgccgcttccgttcgaggcgacggtcagctacggccatgggacggcg
ggtgggccggaggcgatcctgacagcgtctcagcaggttgagttgtatgaccgcgaatac
gacgatgagcctgcgttgcgttatggcgtacacaccttgcccgcacttgcactcccggat
gatccggcagctgcagtcacagccattcgcgctgccacggcggaggcagcgtgcagcggg
aaattcctcgtggcgttgggcggtgagcataccgtcagcgtcggcgtgggactcggcctg
ctcgatgccttaggtggaccgcttaccgtggtgcagatcgacgcccacagcgacctgcgc
gaccaatacgaaggcacgccctacagccacgcctgcattgcgcgccgactgcttgaatcg
ccccacattgaacaggtgctgcagctcggcattcgttcagtctgcaccgaggaagtcgcc
tttgcgcgcagccaccctgaccgcgtcggcatctggtacgccgaggcggtgcatgacgga
agctggcgtagggcgttcattgaacgggtgaagggccgtcgcgtctttctgaccatcgac
gtcgacggtctggatccttcgatcgtgcctgccacgggcacaccggagccggatggcctg
acctggcgcgaaacgctggatattttgcatacgctcaacgaacatgctgaggtcatcggc
atggattgtgtcgaactggcgccgtcgccaggcttgcacatggcggatttcgcggtcgcc
aaactggtttacaaggcgatctcgtacacgatgatgcgcccggctacggggatgcactcc
gtctga

DBGET integrated database retrieval system