KEGG   Caldilinea aerophila: CLDAP_18010Help
Entry
CLDAP_18010       CDS       T01797                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA ligase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cap  Caldilinea aerophila
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLDAP_18010 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLDAP_18010 (sucC)
   00640 Propanoate metabolism
    CLDAP_18010 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CLDAP_18010 (sucC)
Enzymes [BR:cap01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CLDAP_18010 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2262231..2263343
Genome map
AA seq 370 aa AA seqDB search
MFARYGIPVPSGEVATTPSEVRDIAVRLGGSVVVKSQVLVGGRGKAGGIKLARTPDEAEQ
RADEILGMKIKGLTVKKVLVDPIADIRKELYLGAVLDRASRRIVMMASSEGGVDIEEVAA
KTPEKIVKVGAHPFLGLRSHHARILADGIGLPKELTNDFIKIAQGLYQAFINTDASLAEI
NPLVITGDNKLMALDGKISVDDNALFRHPELAEMRDPDEEDPSEREAHRYGLSYIHLDGE
IGCMVNGAGLAMATMDIVKLYGGEPANFLDIGGGAQSDKVAAALRIILSDSRVKAVLINI
FGGITRCDEVARGVLEAIGTLDGRVPFVVRLVGTNEEEGRRILAEANLITATSLADAAQK
AVAAAKGELR
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgcccgctacggcattccggttccgagcggagaagtggcgaccacgccgagcgag
gtgcgcgatatcgccgttcgtcttggcgggtcagttgtggtgaaatcgcaggtattggtc
ggcgggcgtggcaaggcgggcggcatcaagctggctcgcacgccagatgaagccgagcag
cgtgccgacgaaattctgggcatgaaaattaaagggttgacggtgaagaaagtgctcgtc
gaccctatagccgacatccgaaaagaactctatctgggcgccgtgctcgaccgcgccagc
cgacgcatcgtgatgatggcgagcagcgagggcggtgtcgacatcgaagaggtagcagcc
aaaacgccggaaaagatcgtcaaggtgggtgcacatcccttcctcggtttgcgctctcac
catgcccgcatccttgccgacggcatcgggcttcccaaagagctcaccaatgatttcatt
aaaattgcacaaggtctttatcaggctttcatcaacaccgacgccagcctggccgagatc
aacccgctggtcatcacaggcgacaacaagctgatggcgctcgacggcaaaatttcggtc
gacgacaacgcgctcttccggcatcctgagctggccgagatgcgcgacccggacgaggag
gaccccagcgaacgcgaggcgcatcgctatggcctgagttacattcacctcgatggcgag
atcggctgtatggtcaacggcgccggcctggccatggctacgatggacatcgtcaagctg
tatgggggtgagccggccaacttcctcgatatcggcggcggcgctcaatcggacaaagtg
gcggcggcgctgcgcatcattctcagtgacagtcgcgtcaaggcggtgctgatcaacatt
ttcggcggcatcacgcgctgcgatgaagttgcgcgcggggtgctggaggcgatcggaacg
cttgatggccgcgtgcccttcgtcgtccgtctggtcggcaccaacgaggaggaaggtcgg
cgaattctggccgaagccaatttgatcaccgccaccagcctggccgacgctgcgcagaag
gcggtggctgccgccaaaggagaactacgatga

DBGET integrated database retrieval system