KEGG   Caldilinea aerophila: CLDAP_19110Help
Entry
CLDAP_19110       CDS       T01797                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cap  Caldilinea aerophila
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLDAP_19110 (hemD)
Enzymes [BR:cap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CLDAP_19110 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2389987..2390841
Genome map
AA seq 284 aa AA seqDB search
MTPTTPSFVHSSALQGRRIVITQATHQAPAFATLLEHWGAVPLLYPCIAIQSPGDPTPLD
SSLRLAAQGGFDWLVLTSANAVRIVAQRLAALAIAPQRLSALRIAVVGAATARCVQEELG
LEVAVAPQEEVAEGLADALEAVVRPGERILLPQSALARDVLRKRLTAIGASVHPVVAYET
VRGEGGVDLPHLLAQRQVDAVTLASASAFRFLLERLTNEGGEPARLHSVCLACIGPITAR
AVQEAGFIPAVISMQQSLEGLATALADYFARADWHSSQQTQVIP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgaccactccttcctttgtccattcgtcggctttgcagggacgacggatcgta
attacccaggcaactcatcaggcgcctgcgtttgcaacgctgctcgagcattggggtgcc
gttcccctgctctatccttgcatcgccattcagtcgccaggggacccgacaccgctcgat
tcaagcctgcgtctcgctgcgcagggcggtttcgactggcttgtgctgactagcgccaac
gccgtgcgcattgtggcacagcgtctcgccgcactggcgatcgccccccaacgactgagc
gccttgcgcatcgccgttgtaggcgcagcgaccgcccgctgtgtgcaggaggagcttggc
ctggaagtcgccgttgctccccaggaggaggttgccgaaggattggccgatgcgctcgaa
gcggtagtgcgccccggcgaacgcatcctgctgccccagtcggcgttagcgcgcgatgtg
ctccgcaagcgtcttacggcgatcggtgcatccgttcaccccgtcgtcgcctatgaaacc
gtgcgcggtgaaggcggcgtcgatctcccgcatctgctggcgcaacgccaggttgatgca
gtcacgctcgccagcgcgtctgcctttcgcttcttgctggagcgactgacgaatgagggg
ggcgagcccgcacggttgcacagcgtttgcctggcatgcatcgggccgatcacggcgcgc
gctgtacaggaagccggcttcatccctgccgtcatctccatgcagcagagcctggaagga
ctggctacggcgttggccgactatttcgcccgtgcagactggcacagttcacaacaaact
caggtgatcccatga

DBGET integrated database retrieval system