KEGG   Caldilinea aerophila: CLDAP_19210Help
Entry
CLDAP_19210       CDS       T01797                                 

Gene name
pdhC
Definition
pyruvate dehydrogenase E2 component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cap  Caldilinea aerophila
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLDAP_19210 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLDAP_19210 (pdhC)
   00020 Citrate cycle (TCA cycle)
    CLDAP_19210 (pdhC)
   00620 Pyruvate metabolism
    CLDAP_19210 (pdhC)
Enzymes [BR:cap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CLDAP_19210 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2405189..2406448
Genome map
AA seq 419 aa AA seqDB search
MAEFRMPSLGADMQSGKLLEWLVKPGDVVKRGQVIAVVGTEKGDIEVEVFEEGVVRALLA
APGTEMPVGAPIAIIEGEAEAEKVATVLASRPADVTGEATKTVAEKVTAVPASRPANGQR
IRVSPLARKLAAELGIDLSQVRGTGPQGAIDKADVERAAAALKAQQEAPPPAPTQPVEAP
APPPPAKPVDKSSAEFQAGMRRAIALAMARSNREIPHYYLETRVNMAKALAWLEAENLKR
PIQNRLLPAVLLIKAVAKALTQVPQLNGYWIDDALQVAEAIHIGFAIALRQGGLVTPAIH
HADLKSADELMETLRDLIMRTRAGRLRSSELTDATITLTSLGDMGVEKVFGVIYPPQVAL
VGFGKVTEEVWVENGMIGVRPVVYATLAGDHRASDGRTGAEFLDVLNRLLQEPETLFSA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtttcgaatgcccagtctgggcgccgatatgcagtcaggcaagctgttggaa
tggctggtcaagcccggtgatgtcgtcaagcgcggacaggtgatcgcagtcgtcggcacg
gagaagggcgacatcgaggtggaggtcttcgaggaaggtgtggtgcgtgcgctgctggcc
gcgccgggcacggagatgccggtcggtgcgccgatcgccatcatcgagggcgaagcggag
gcggagaaggtcgctaccgtgctggcctctcgccctgcagatgtaaccggagaggcaacg
aaaaccgtggcggaaaaggtcaccgctgtgccagcctcccgccctgccaacggtcagcgc
attcgcgtctccccgctggcacgcaagctggccgcagagctgggcatcgatctcagccag
gtgcggggtactggcccacagggcgccatcgacaaggcggacgtcgaacgcgcggctgca
gcgctcaaagcacaacaggaggctccaccccctgcgccgacacagcctgtggaagcgcct
gcgcctccaccgccggcaaaaccggtcgacaagagcagcgccgaatttcaggccggcatg
cgccgcgccattgcgctggcgatggcgcgctcgaaccgcgagatcccgcactactacctg
gagacgcgcgtcaacatggcgaaggcgctggcttggttggaggcggagaatctcaaacgg
ccgatccagaatcgcctgctgcctgccgtgctgctgatcaaggccgtcgccaaagcgctc
acgcaggttccccagctcaacggctattggatcgacgacgcgctgcaggtcgccgaggcg
attcacatcggtttcgccatcgcgctgcgacagggcggactggtcacgcctgctattcac
catgccgacctcaagagcgcagatgagctgatggagaccctgcgcgacctgattatgcgc
acgcgcgccggccgtctgcgcagctcggagctgaccgacgccacgatcaccctgacgagt
ttgggggacatgggtgttgagaaggtcttcggcgtcatctatccgccgcaggtggccctg
gttggctttggcaaggtgacggaggaggtgtgggtggaaaacggcatgatcggggtgcgg
ccggtcgtgtatgccacgctggccggcgatcatcgcgccagtgacggacgcaccggcgct
gaattcctggatgtattgaatcgactgctgcaggagccggagacacttttcagcgcgtga

DBGET integrated database retrieval system