KEGG   Caldilinea aerophila: CLDAP_20040Help
Entry
CLDAP_20040       CDS       T01797                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cap  Caldilinea aerophila
Pathway
cap00260  Glycine, serine and threonine metabolism
cap00750  Vitamin B6 metabolism
cap01100  Metabolic pathways
cap01110  Biosynthesis of secondary metabolites
cap01120  Microbial metabolism in diverse environments
cap01230  Biosynthesis of amino acids
Module
cap_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLDAP_20040 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLDAP_20040 (thrC)
Enzymes [BR:cap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLDAP_20040 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAM00044
UniProt: I0I456
Position
2517326..2518351
Genome map
AA seq 341 aa AA seqDB search
MPLFDPASIQPKIAGMWRYEAMLPVIRNGYDRITLGEGWTPLIPDRWAGRSLYWKLDALM
PTGSYKDRGICVMVNWLRGLGYEALADDTSGNAGASLACYAGRAGMRAVIFVPATAPAPK
KAQIMVYGAELVEVPGTRAEATNAVEMATSTSREMAYASHAWHPAFLLGQMTVAWEIWEQ
LGGVVPDWLIAPVGHGGTLLGAWRGFQHLRVSGVTNKLPRLIAVQAEPYTPLYDAFVSGA
ATIEPTPHVQVISADGIAISYPVRWQALLEAIRFSHGTVLAVNDQEVTEAHGELASRGIF
VEPTSATIAAALKKTQTEVIPNRDLVVGILTGHGLKKIPKI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgccactcttcgatcctgccagcatccagccaaaaatagcgggaatgtggcgatatgaa
gcgatgttgccggtgattcgcaacggctacgaccgcattaccctcggtgaaggatggacg
ccgctgatccccgaccgatgggcaggtcgctcgctgtactggaaattggacgcgctgatg
cccaccggcagctacaaagatcgcggcatctgtgtgatggtaaactggctgcgcgggctg
ggatacgaagcactggcagacgacaccagtgggaacgccggcgccagcctggcctgctat
gccggccgcgctggcatgcgtgcagtcatttttgttcctgccactgcgcctgctccgaaa
aaggcgcagatcatggtctatggcgccgaactggttgaggtgcccggcacgcgcgcggag
gccacgaatgccgtcgagatggcaacctccaccagccgtgaaatggcctatgcctcccac
gcctggcatcctgcgtttctgctggggcagatgaccgtagcgtgggagatctgggagcaa
ttaggcggcgtcgtgcccgactggttgattgcaccggtcgggcatggtggtacgctgctg
ggcgcctggcgaggttttcagcatctgcgcgtctccggcgtgaccaacaagctgccccgc
ctgatcgctgtgcaggctgagccgtacaccccgctgtacgatgccttcgtcagcggcgct
gcgacaatcgagccgacgcctcacgtgcaggtgatcagcgccgatgggatcgccatcagc
tatccggtgcgctggcaggcgctgttggaggcgattcgtttctcgcacggcacggtcctg
gccgttaacgaccaggaggtcacagaggcacatggggagctcgccagccggggaatcttt
gtcgaacccaccagcgccaccattgcagccgcactgaaaaaaacgcaaacagaggtcatt
ccaaatagggacctcgttgtgggcattctgaccggccacggtctcaaaaaaataccaaaa
atttaa

DBGET integrated database retrieval system