KEGG   Caldilinea aerophila: CLDAP_21920Help
Entry
CLDAP_21920       CDS       T01797                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cap  Caldilinea aerophila
Pathway
cap00010  Glycolysis / Gluconeogenesis
cap00052  Galactose metabolism
cap00500  Starch and sucrose metabolism
cap00520  Amino sugar and nucleotide sugar metabolism
cap00521  Streptomycin biosynthesis
cap01100  Metabolic pathways
cap01110  Biosynthesis of secondary metabolites
cap01120  Microbial metabolism in diverse environments
cap01130  Biosynthesis of antibiotics
cap01200  Carbon metabolism
Module
cap_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cap_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLDAP_21920 (glk)
   00052 Galactose metabolism
    CLDAP_21920 (glk)
   00500 Starch and sucrose metabolism
    CLDAP_21920 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CLDAP_21920 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLDAP_21920 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CLDAP_21920 (glk)
Enzymes [BR:cap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLDAP_21920 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Hydant_A_N DUF3355
Motif
Other DBs
NCBI-ProteinID: BAM00232
UniProt: I0I4P4
Position
complement(2738122..2739087)
Genome map
AA seq 321 aa AA seqDB search
MDSFVAGVDLGGTKTEVGLIAPDNHIAARRRFPTEDRLGPHSVAERIAASIAEMEQQLLV
KERVAAVGVCTPGPVDHVAGVLLDPPNIPGLHYAPLAALLGERLGVPVRIDHDAKAAGLG
EFHYGAGRGERSMVYIIVGTGVGAAIIADGQIYRGMHNSAGEFGHTTLDRNGVLCSCGAR
GCVETFMSGPWLARRYAAAQRGEAPTLETPTLLDGQQVAALAQQGDPLALRILTEAGEAL
GVAIATLAMILDIECYVIGGSVAHCGDLLLKPARRMAPRYSFRSVGERVRIVKNQLDTDA
ALLGCAWLARQALKMTQGDNP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggacagcttcgtagcaggcgtcgacctgggcggcaccaaaactgaagtcgggctgatc
gcgccggacaaccacattgcggccagacgacgctttcccaccgaagaccgtctggggccg
cactccgtagcggagcggattgcagcgagcattgcagaaatggaacagcagctcctcgtt
aaggaacgcgtggctgcggtgggcgtctgcacgcccgggccggtcgatcacgtagcaggc
gtgttgctggatccgcccaacatccctggcctgcactatgcgccgctggcagcgctgctc
ggcgaacgactcggcgtgcccgtgcgcatcgatcatgatgccaaggcagccggcctgggc
gaatttcactacggcgcaggtcgcggagagcgcagcatggtgtacatcattgtcggcacg
ggcgttggcgcagccatcatcgccgatggacaaatctaccgcgggatgcacaactcggcg
ggtgagttcggccacaccacgctggatcgcaatggtgtcctctgctcctgcggtgcgcgc
ggctgtgttgagaccttcatgagcggcccatggctggcgcgtcgctatgcggcggcacaa
cgtggggaagcgccgacgctggaaacaccaactctgttggacggtcaacaggtggcggcg
ctggcgcagcagggtgaccccctggcattgcgcatcctcaccgaggcgggcgaagcgctc
ggcgtcgccattgcaaccctggccatgatcctggacatcgagtgttacgtgatcggtggc
tcggtggcgcactgcggcgatctgctcctgaaaccggcgcggcgcatggcgcctcgctac
agctttcgctccgtgggcgagcgcgtgcgcattgtgaaaaatcaactggataccgatgca
gccctgctgggatgcgcctggctggcgcgccaggcattgaaaatgacgcaaggagacaac
ccatga

DBGET integrated database retrieval system