KEGG   Caldilinea aerophila: CLDAP_23550Help
Entry
CLDAP_23550       CDS       T01797                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cap  Caldilinea aerophila
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLDAP_23550 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLDAP_23550 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLDAP_23550 (thrC)
Enzymes [BR:cap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLDAP_23550 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2942962..2944323
Genome map
AA seq 453 aa AA seqDB search
MLAEIAPAPTRTYNAHFRCFRGCPGEYSVYEVMYTCPRCGGLLEVHHDIEALRDRSAEEW
KALLERRAGTTVWPYGSGVWGMREWVIPDLRDENIVSMYEGNTNLFWAERLGKDIGVPDL
WVKLCGNSHTGSFKDLGMTVLVSVVKQMMASGKSPVRAVAAASTGDTSAALAAYAAAAGI
PAIIFLPSGKVSTAQLIQPVANGAHVLALDTDFDGCMRIVKEVTQDNSIYLANSMNSIRI
EGQKTVGIEIVRQFDWEVPDWIIIPVGNLGNISALYKGLKLIQDLGIIDRLPRLVAAQAD
KANPFYRSFLNGFREKVTIRADRTLASAIQIGDPVSYEKAVQAVVETNGLVEAVTEHELA
NAAARADLTGMYTCPHTGVALAALFKLVARGEIKSSDRVVVISTAHGLKFTSFKVGYHEG
RLEEVESELANPPIYLPADVKVVKETIARRLQL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgttagctgaaatcgcacccgcccccactcgaacctacaacgcccacttccgctgcttt
cgcggctgtccgggcgaatactccgtctatgaagtgatgtacacctgccctcgatgcggc
ggtttgctcgaggtgcaccacgacatcgaggccctgcgcgatcgcagcgctgaggagtgg
aaggctctgttggagcgacgagcgggtaccaccgtatggccttacggcagcggcgtatgg
ggcatgcgggaatgggtgattcccgacctgcgcgatgaaaatatcgtgagcatgtatgaa
ggcaacaccaatctcttctgggcggagcgattgggcaaagatatcggcgtgcccgacctg
tgggtcaagctctgcggcaacagccacacgggcagctttaaggacctggggatgaccgtg
ctggtcagcgtcgtgaaacagatgatggcgagcggcaaaagcccggtgcgggcggtggct
gcggccagtaccggcgacacgtcggctgcgcttgccgcctatgccgcagcggcaggcatt
ccggcgatcatcttccttccctcaggcaaagtcagcaccgcacagttgattcagccggtc
gccaacggcgcgcacgtgctggcgctggataccgacttcgacggctgcatgcgcatcgtc
aaggaggttacccaggacaacagcatctacctggcgaattcgatgaacagcattcgcatt
gaagggcagaagaccgtcggcatcgagatcgtgcgccagtttgactgggaggttcctgac
tggatcatcattccggtcggcaacctgggcaacatcagcgccctctacaaaggactcaag
ttgattcaggatttgggcatcatcgaccggctgccaaggttggtggcggcacaggcagat
aaagcgaatcccttctatcgcagctttttgaacggtttccgagagaaagtaacgatccgc
gccgacaggaccctggcttccgccatccagatcggcgatccggtgagctatgaaaaagcg
gtgcaggcagtcgtcgagaccaacgggctggtcgaagcggtaacggagcatgagttagcc
aacgccgccgcgcgtgctgatctcactggcatgtacacctgcccacacacgggcgtggcg
ctggcggcgcttttcaagctcgtggcgcgaggggagatcaagtcaagcgaccgcgtggtg
gtgatttcgactgcgcacgggttgaaattcaccagcttcaaggtcggctatcatgagggc
aggctggaagaggtagaaagcgagttagccaacccgccgatctatcttcctgcggacgta
aaggtggtgaaagagacaatcgctcgccggctgcagctataa

DBGET integrated database retrieval system