KEGG   Caldilinea aerophila: CLDAP_23740Help
Entry
CLDAP_23740       CDS       T01797                                 

Definition
putative phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cap  Caldilinea aerophila
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CLDAP_23740
Enzymes [BR:cap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CLDAP_23740
Transfer RNA biogenesis [BR:cap03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CLDAP_23740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2964761..2965627
Genome map
AA seq 288 aa AA seqDB search
MTEQRIETLDLTRELELATRLAREAAIIVNTFYIGSSEVRYKSDDEPVTEADRSANQHIV
ARLRAAFPDDGILSEESKDDLSRLQKSRVWIVDPLDGTKEFIARNGEFSIMIGLAIEGRP
VLGVIQQPATGLLYAGVVGQGAYMIEDDERIDLHVSDCANLRDMIMVSSRSHRQQIVDII
RARLNITRERVSGSVGLKVGLITRQLADLYIHPSPGCKEWDLCAPQALLEAAGGRITDCW
GNPLRYNQRDVRAHNGLIATNGVLHDQIVEVVAAVCEEFGYNQDDGFW
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacaacgaattgaaacgctggatttgactagagaactggagcttgcgaccaga
ctggcgcgcgaggcggctattattgtcaatactttttacattggttcatctgaggtgcgt
tataaatctgacgatgagccggtgactgaagccgaccgcagcgccaaccagcacatcgtg
gcgcggctgcgcgccgcctttcccgacgacggcatcctttccgaggaatcgaaggatgac
ctcagccgcctgcagaagtcacgcgtctggatcgtagacccactcgacggcacgaaagag
ttcattgcccgtaacggtgagttttccatcatgatcgggctggccatcgaaggacgacct
gtcttaggtgtgattcagcagcccgctaccggcctcctttacgccggcgttgtcggtcag
ggggcatacatgatcgaagatgatgagcgtatcgacctgcatgtcagcgactgtgccaac
ctgcgcgacatgatcatggtcagcagccgcagccatcgtcagcagatcgtcgacatcatc
cgtgcccgactcaatatcacccgcgaacgcgtatcgggcagcgtagggctgaaagtcggg
ttgattacccgtcagctcgccgatctctacatccatcccagccctggctgcaaggagtgg
gatctctgcgcgccacaggcgctgctggaggcagccggcgggcgcatcaccgactgttgg
ggcaatccgttgcgctacaaccagcgcgatgtgcgcgcccacaacgggttaatcgccacc
aacggcgtcctccacgaccagattgtggaggtcgtggccgcagtctgcgaggaattcggc
tacaaccaggatgatggattttggtga

DBGET integrated database retrieval system