KEGG   Caldilinea aerophila: CLDAP_25120Help
Entry
CLDAP_25120       CDS       T01797                                 

Definition
(GenBank) putative beta-N-acetylhexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cap  Caldilinea aerophila
Pathway
cap00520  Amino sugar and nucleotide sugar metabolism
cap01100  Metabolic pathways
cap01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CLDAP_25120
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    CLDAP_25120
Enzymes [BR:cap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CLDAP_25120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: BAM00552
UniProt: I0I5L4
Position
complement(3134316..3135518)
Genome map
AA seq 400 aa AA seqDB search
MFGAGTLALAGCTTPGVSAMSGRELAAFVAAVSHQNKKTQDKKPPMPSATIHPKLVKPDV
ALEVKIGQMLMLGFRGTTAKEDPAIVRALTEQHIGGVVLFDVDVGGRRPRNIVSPQQVAA
LTAELQALATLPLIVSVDQEGGKVARLNEKYGFPATLSAAALGERNDPEFTRAEASKMAR
TLAEVGITLNLAPVVDVRIQPDSPIIARPGRSFSADPAVVAAQAEAFIDGHHAHGVRCTL
KHFPGHGSASGDTHLGFTDVTESWREEELIPYRELIGKGKVDAVMTAHVFNARLDPALPA
TLSPAIVTGLLRQTLGYDGVVISDDMQMRAVTDHYSLEKAFELAILAGVDIIAVANNVTY
TGTISDRFMTTVMRLLEEQVIDEARIEQSYRRILKLKGLA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtgtttggtgcaggcacgctggcgctggcaggctgcaccacccctggggtctcggcgatg
tcaggccgggagcttgcagcgtttgtggcggcagtcagccatcaaaacaaaaagacacaa
gacaaaaaaccaccgatgccttctgcaaccattcaccctaaactggtcaaacccgacgtt
gcgctggaagtgaagatcgggcaaatgttgatgctcggcttccgcgggacgacggccaag
gaagatccggctatcgtgcgcgcgctgaccgaacaacacatcggcggcgtcgtgctcttt
gatgtcgacgtaggagggcgacggccacgtaacattgtgtcgccacagcaggttgctgcg
ctgaccgctgaactgcaggcgttggccaccctgccgctgatcgtcagcgtcgaccaggaa
ggcgggaaggttgcccggctgaacgaaaagtatggctttccggcgaccctctccgcagcc
gcgctgggcgaacgcaacgatccagaattcacgcgggcggaggcaagcaagatggcgcgg
acgttggcggaggtgggcatcaccctcaacctggcgccggttgtcgacgtgcgcatccaa
cccgacagccctatcatcgcccgccccggccgcagcttttcggccgatccagccgtcgtc
gccgcacaggcagaagccttcatcgacggccaccatgcacatggcgttcgttgcacgctc
aagcattttccaggccacggcagcgcgtcaggggatacgcacctcggcttcaccgatgtg
accgaaagctggcgcgaggaggaattgatcccctatcgcgagctgatcggcaaaggcaaa
gtggacgctgtcatgacagcgcacgtcttcaacgcccggctcgatcccgcactgcccgcc
accctttctcccgccatcgtgaccggactgctgcgccagacgctcggctacgatggcgtc
gtcatcagcgacgacatgcagatgcgcgctgtgaccgaccactacagcctggaaaaggcc
ttcgagctggcgatcctggccggggtggacatcatcgcggttgccaacaatgtgacctac
accggcacaatctccgatcgctttatgacgactgtcatgcggctgctcgaagagcaggtg
atcgacgaagcgcgcatcgagcaatcctatcgacgcattctgaagctcaaagggttggcc
tga

DBGET integrated database retrieval system