KEGG   Caldilinea aerophila: CLDAP_25120Help
Entry
CLDAP_25120       CDS       T01797                                 

Definition
putative beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
cap  Caldilinea aerophila
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cap00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:cap00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3134316..3135518)
Genome map
AA seq 400 aa AA seqDB search
MFGAGTLALAGCTTPGVSAMSGRELAAFVAAVSHQNKKTQDKKPPMPSATIHPKLVKPDV
ALEVKIGQMLMLGFRGTTAKEDPAIVRALTEQHIGGVVLFDVDVGGRRPRNIVSPQQVAA
LTAELQALATLPLIVSVDQEGGKVARLNEKYGFPATLSAAALGERNDPEFTRAEASKMAR
TLAEVGITLNLAPVVDVRIQPDSPIIARPGRSFSADPAVVAAQAEAFIDGHHAHGVRCTL
KHFPGHGSASGDTHLGFTDVTESWREEELIPYRELIGKGKVDAVMTAHVFNARLDPALPA
TLSPAIVTGLLRQTLGYDGVVISDDMQMRAVTDHYSLEKAFELAILAGVDIIAVANNVTY
TGTISDRFMTTVMRLLEEQVIDEARIEQSYRRILKLKGLA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtgtttggtgcaggcacgctggcgctggcaggctgcaccacccctggggtctcggcgatg
tcaggccgggagcttgcagcgtttgtggcggcagtcagccatcaaaacaaaaagacacaa
gacaaaaaaccaccgatgccttctgcaaccattcaccctaaactggtcaaacccgacgtt
gcgctggaagtgaagatcgggcaaatgttgatgctcggcttccgcgggacgacggccaag
gaagatccggctatcgtgcgcgcgctgaccgaacaacacatcggcggcgtcgtgctcttt
gatgtcgacgtaggagggcgacggccacgtaacattgtgtcgccacagcaggttgctgcg
ctgaccgctgaactgcaggcgttggccaccctgccgctgatcgtcagcgtcgaccaggaa
ggcgggaaggttgcccggctgaacgaaaagtatggctttccggcgaccctctccgcagcc
gcgctgggcgaacgcaacgatccagaattcacgcgggcggaggcaagcaagatggcgcgg
acgttggcggaggtgggcatcaccctcaacctggcgccggttgtcgacgtgcgcatccaa
cccgacagccctatcatcgcccgccccggccgcagcttttcggccgatccagccgtcgtc
gccgcacaggcagaagccttcatcgacggccaccatgcacatggcgttcgttgcacgctc
aagcattttccaggccacggcagcgcgtcaggggatacgcacctcggcttcaccgatgtg
accgaaagctggcgcgaggaggaattgatcccctatcgcgagctgatcggcaaaggcaaa
gtggacgctgtcatgacagcgcacgtcttcaacgcccggctcgatcccgcactgcccgcc
accctttctcccgccatcgtgaccggactgctgcgccagacgctcggctacgatggcgtc
gtcatcagcgacgacatgcagatgcgcgctgtgaccgaccactacagcctggaaaaggcc
ttcgagctggcgatcctggccggggtggacatcatcgcggttgccaacaatgtgacctac
accggcacaatctccgatcgctttatgacgactgtcatgcggctgctcgaagagcaggtg
atcgacgaagcgcgcatcgagcaatcctatcgacgcattctgaagctcaaagggttggcc
tga

DBGET integrated database retrieval system