KEGG   Caldilinea aerophila: CLDAP_27210Help
Entry
CLDAP_27210       CDS       T01797                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cap  Caldilinea aerophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLDAP_27210 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLDAP_27210 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLDAP_27210 (trpB)
Enzymes [BR:cap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CLDAP_27210 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3392849..3394057
Genome map
AA seq 402 aa AA seqDB search
MAWPDETGHFGPYGGKFVPETLMPALDELEEVYLKAKHDKEFQAELDHLLRTFVGRPTPL
TYARRLTEYFGGPRIYIKREDLAHTGAHKINNALGQALLMKRKMQKTRIVAETGAGQHGV
ATATAAAMLGIECVVYMGTVDMARQEPNVYRMRLLGAEVRGVDSGSKTLKDAINEAIRDW
VTNVRNTHYLLGSALGPHPYPTIVRDFQSIIGREALRQMLDPETGPGRLPDAIVACVGGG
SNAIGIFHPFLEYESVRLIGVEAGGRGIEGGEHAARFADPRLGRLGVLQGTKSYVLQDED
GQIALTHSISAGLDYASVGPEHAWLRDLGRTEYTYATDDEALEGVRLLSRLEGIIPALES
AHAIAHLMKLAPQMSKNEVILVNLSGRGDKDLGTIMKELGAL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcctggcctgacgagaccggccatttcggcccctatggcggcaaattcgtgcccgaa
acgctcatgcctgccctcgatgagctggaggaggtctatctcaaggcaaagcacgacaaa
gagtttcaggccgaactcgatcacctgctgcgtaccttcgtggggcggccgacgccgctc
acctatgcacggcgattgaccgaatacttcggcgggccgcgcatttacatcaaacgcgaa
gaccttgcccacaccggcgcgcacaagatcaacaacgcgttggggcaggcgctgctgatg
aaacgcaaaatgcaaaagacgcgcatcgtggccgaaaccggtgccggccagcatggcgtc
gccactgccacggcggccgctatgctcggcattgagtgcgtagtctacatgggaacagtc
gatatggcgcggcaggaaccgaacgtctatcgcatgcggctgcttggcgccgaggtgcgt
ggagttgactccggcagcaaaacattgaaggatgccatcaacgaagcgatccgcgactgg
gtgaccaacgtgcgcaatacgcattatctgctcggcagtgcgctcggcccccatccttat
cccaccatcgtgcgcgatttccagagcatcatcggccgtgaggcgctgcgtcagatgctc
gacccggagaccggccccggacgcctgcccgatgcgatcgtcgcttgcgttggcggcggc
tcgaatgccatcggtatcttccaccccttccttgaatatgaaagcgtgcggctgatcggc
gtagaagcaggaggtcgagggatcgaagggggagagcacgcggcgcgctttgcggatccc
aggttggggcgattgggcgtattacaaggcacaaagagctatgtcctgcaagatgaagac
ggccagatcgcattgacacatagcatcagcgccggcctggactatgccagcgtcggccca
gagcacgcctggttgcgcgatctgggccgcactgaatacacctacgccaccgacgacgaa
gcgttggagggcgtgcggttgctgagccggctggaggggatcatcccagctctggaaagc
gcccatgcaatcgcacacctgatgaagctggcgccgcagatgagcaaaaacgaagtcatc
ctggtcaacctgagcggtcgcggggataaagacctcggcacgattatgaaagagcttggc
gcactatga

DBGET integrated database retrieval system