KEGG   Caldilinea aerophila: CLDAP_27220Help
Entry
CLDAP_27220       CDS       T01797                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cap  Caldilinea aerophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLDAP_27220 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLDAP_27220 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLDAP_27220 (trpA)
Enzymes [BR:cap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CLDAP_27220 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3394054..3394872
Genome map
AA seq 272 aa AA seqDB search
MTGLERIEAVFHRCRKEGHAAFMPYHAMGYPSREKTLKIIHTLSEVGADLFEIGIPHSDP
LADGPTIQTATYTALMQGTTVRDCLSMVRELRAMGVTQPFCAMSYYNPIFAYGVNRFVED
AAASGIDGLIVPDLPPEEAGELEAACRQAGLATIFLLAPTSTDARIRYVASHCTGFIYLV
SVTGITGARTELPPDLAEFVARVRRHTDLPLAVGFGIANGEQAAAVARIAEGVIVGSALI
KAAGGEDGLQRVAALGRELAHGAHHPCSNGVS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgactggtctggaacgtattgaagccgtatttcatcgctgccgcaaagagggccacgca
gccttcatgccctaccatgcaatggggtatccctcccgggaaaagaccctgaaaattatt
cacaccctgagtgaagtcggcgccgatctcttcgagatcggcatccctcacagcgatccg
ctcgccgatggaccgaccatccaaacggccacctacacggcgctgatgcagggcacgacg
gtgcgagattgcctgtcgatggtgcgcgagctgcgggccatgggtgtgacgcagcccttt
tgcgcgatgagctattacaatccgatcttcgcttacggtgtgaatcgtttcgtggaagac
gctgcagcgtccggtatcgatggcctgatcgtgcccgatctgccccctgaagaggcagga
gagctggaggccgcctgtcgtcaggcaggcctggcgacgatttttttgctggcgccgacc
agcaccgacgcgcgcatccgctacgtagcgtcgcactgcaccggctttatctatctggtc
agcgtcaccggcatcaccggcgcacgtactgagctgccgccggacctggccgaatttgtg
gcgcgcgtgcgccgccacactgacctgcccctggctgtcggcttcggcattgccaacggc
gaacaggcagccgcagtcgcccgcattgctgaaggcgtcatcgttggctctgcgttgatc
aaggctgctggcggcgaggatggcttgcagcgcgtggctgcgctgggccgcgagctggct
catggcgcccatcatccctgctcaaacggagtttcatga

DBGET integrated database retrieval system