KEGG   Caldilinea aerophila: CLDAP_27530Help
Entry
CLDAP_27530       CDS       T01797                                 

Gene name
ugp
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cap  Caldilinea aerophila
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CLDAP_27530 (ugp)
   00052 Galactose metabolism
    CLDAP_27530 (ugp)
   00500 Starch and sucrose metabolism
    CLDAP_27530 (ugp)
   00520 Amino sugar and nucleotide sugar metabolism
    CLDAP_27530 (ugp)
Enzymes [BR:cap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CLDAP_27530 (ugp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3430690..3432063)
Genome map
AA seq 457 aa AA seqDB search
MRSAGLSQTFIDNFRFYYEQLVQGATGYISREEAQPVETLPSYQELDTSLQRAGEHALSR
TLVLKLNGGLGTSMGMDGPKSLLPVKGDLTFLDIIVRQVLALRRRFDLPIPLVLMNSFYT
RTATLHALEAYPELKEQGVPLDFMQHMEPKIWKESLLPAEWPNDPDKEWCPPGHGDIYTA
LVDSGMLKALLDTGYEYAFVSNVDNLGAVLDLAILGYFADQRIPFLMEVAQRTPADRKGG
HLARSRDGRLILRESAQCPPEEEAEFQNIRLYRYFNTNNLWMNLRALAEMLERRHGVLGL
PLIRNEKPIDPTDPTTPRVYQLETAMGSAIGIFEDAQALCVPRSRFAPVKKNSDLLVLMS
DAYHLNEDYTLSLAPECNGTPPVVTLDDRYYLLYDAMKARFPAGAPSLRRCISLTVRGDV
TFGAAVTVLGSVVVEAPEGESLHLPDGAVLGETEVAS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagcgccggcctttcccagaccttcatcgacaattttcgtttttactacgaacag
ctcgtccagggcgcaaccggctatatttctcgtgaggaggcacaacctgtggaaacgctg
ccctcctatcaggagctggacacctccttacaacgcgcaggtgagcacgcactctcccgt
accctggtgctgaagctgaacggcggactcggcaccagtatgggcatggatggccccaag
tcgctgctgccggtcaagggcgatctcactttccttgatatcatcgtgcgtcaggtgttg
gcactgcgcagacgctttgacctaccgatcccattggtgctgatgaacagcttctacacc
cgtaccgccacgcttcatgctttggaggcctatcctgaattgaaggaacagggtgttccg
ctcgacttcatgcagcacatggaaccaaagatctggaaggaatcgctgttgcctgcagag
tggcccaacgatccagacaaagagtggtgcccgcctggacatggcgatatttacacagcg
ctggtggacagcgggatgttgaaagctctgctcgatacagggtatgagtatgcctttgtc
tccaacgtagacaacctgggcgccgtgctcgatctcgccatcttgggctacttcgccgac
cagcgcattccttttctgatggaggtggcgcaacgcactcccgccgaccgcaagggcggt
catctggcgcgcagccgcgacggtcgcctgatcctgcgcgagtcggcacagtgtccgcct
gaagaagaggccgaatttcaaaacattcgcctctatcgatatttcaacacgaacaatctg
tggatgaacctgcgtgcgctggcagaaatgctcgaacggcgccacggtgtgttggggctg
ccgttgatccgcaacgaaaaaccgatcgacccgactgacccgacaacccctcgcgtctat
caactggagacggcgatgggctcagcgatcggcatcttcgaggatgcgcaggcgctctgc
gtgccgcgcagccgctttgcaccggtcaaaaaaaacagcgacctccttgtcctgatgtcg
gacgcctaccacctcaacgaagattacacgctctcgctggcgcctgaatgcaacggaacg
ccccctgtcgtaacgcttgatgaccgctattacctgctgtatgacgccatgaaagcccgc
ttcccggctggcgcgccttcactgcgtcgttgcatcagcctgacagtgcggggagatgta
accttcggcgccgcagtgacagttttgggcagcgttgtggtggaagctccagagggagag
tcgctgcaccttcctgacggcgccgtgctgggggaaactgaggtggcttcataa

DBGET integrated database retrieval system