KEGG   Caldilinea aerophila: CLDAP_29200Help
Entry
CLDAP_29200       CDS       T01797                                 

Definition
putative esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cap  Caldilinea aerophila
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3626113..3627126
Genome map
AA seq 337 aa AA seqDB search
MGKASKAGWLITGALMGYLGYERLWRQPPLLEIPAARPLKDFASAVEAAQSQVAESESGV
RPDCAGKLFTHGRQTDRAILLLHGFTNCPRQFHALAERYYERGYNVYVPRFPYHGLYNRA
PRELMQLTSEDLVRTGMAALDIARGLGRYVMVMGLSMGGLVAAWLAQHREDIDRAVMVAP
ALAFRAIPFRLMPLYATYARYAPNRFIWWDPELKGAAPGPEHAYYGFHLRSLQALLRLAI
LVGETTRRRAARARSLVVILNPTDESIDNEGVCTVVRRWRRRGSNILLYEFPAAWGLPHD
LIDPDQPAQQIERVYPLLIEWSEYPYYVTAAPKQPSL
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaggcaagtaaggctggctggctcattactggcgcgttgatgggctatctggga
tacgagcgtctatggcgacaacctcccctgcttgaaatccctgcagcccgtcctctgaaa
gactttgcctcggctgtcgaggctgcccagtctcaggtagccgagagtgaatcaggagtg
cgtcccgactgcgccggcaagctcttcacgcatgggcgacagaccgatcgggccatcctg
ctcctgcatgggttcacgaactgtccccggcaatttcatgccctggcggagcgctattac
gaacgcggctacaacgtctacgtgccgcgtttcccctaccacggcctgtacaatcgggca
cccagagagctgatgcagttgacttcagaagacctggtgcgcaccggcatggcggccttg
gatattgcgcgaggactggggcgttatgtgatggtcatggggctttccatgggtggcctc
gtggcggcatggctggcgcagcatcgagaggacatcgatcgggctgtgatggtggcgcca
gcactggcgtttcgggcgattccttttcgactcatgccgctctacgccacctatgcccgc
tatgcgcccaatcgcttcatctggtgggacccagagctgaaaggcgccgcgcctggacct
gaacacgcctactatgggttccatctccgatctcttcaggcgctgttgcgactggccata
ctggttggagagacgacccggcgtcgcgcggccagggcacgttcccttgtcgtcatcctc
aacccgaccgacgaatcgatcgataacgagggcgtgtgcactgttgtgcggcgatggcgt
cgtcgtggctccaacatcctgttgtatgaatttcctgcggcgtgggggcttccacatgac
ctgatcgaccctgaccagcctgcacagcaaatcgagcgcgtctatcctttgctcatcgaa
tggagcgaatacccctattacgtgacggctgcccctaaacaaccttccctgtga

DBGET integrated database retrieval system