KEGG   Caldilinea aerophila: CLDAP_29740Help
Entry
CLDAP_29740       CDS       T01797                                 

Definition
putative glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cap  Caldilinea aerophila
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLDAP_29740
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLDAP_29740
   00052 Galactose metabolism
    CLDAP_29740
   00500 Starch and sucrose metabolism
    CLDAP_29740
   00520 Amino sugar and nucleotide sugar metabolism
    CLDAP_29740
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLDAP_29740
   00524 Butirosin and neomycin biosynthesis
    CLDAP_29740
Enzymes [BR:cap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLDAP_29740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3689383..3690381)
Genome map
AA seq 332 aa AA seqDB search
MILAGVDLGGTKIAVVILQTAGDLDDTGGGETGGHTLARVSAPTDSHEGPEAVLRRIATL
VRQACADAYLDVADLAAVGLGVPGVYDLKTGYTLFLPNLAGAWRNVPAGPFLQEALERPV
WLINDARAFVLAETLLGAGRGAQTVVGFTLGTGVGGGIAINGQLFWGIDGTAGEIGHLTM
DPDGPLCTCGNRGCLETYASGVAIQKLAMRRLADAPDSLLLQLADGDPTRVTPALVGQAA
TMGDATAQSILAHVTKYLGVGVANIVTTLSPDCVVLGGSVANLGEQLLAPVRAIVRERCR
AIPVDRVRIVQAELGPDAGAIGAALWARQQGR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatcctggcaggcgtcgatctgggcggcactaaaatcgccgtagtgatccttcaaact
gcaggtgaccttgacgatacaggcgggggcgaaacaggcgggcacacgctggcacgcgtg
tcggcgccgaccgattcccatgaagggccagaggcagtgctacggcgtattgcgacgctg
gtgcgacaggcctgtgccgatgcctatctcgacgtggccgatctggcagccgtcgggttg
ggcgtgcccggtgtatacgacttgaagaccggctacacgctctttctgcccaatctggcc
ggcgcatggcgcaatgtgccggcggggccattcctgcaggaggcgctggagcgaccggta
tggttgatcaacgatgcgcgcgcctttgtgttggcagagactttgctcggcgcaggccgc
ggtgcgcagacagtggtaggcttcacgctgggaacaggcgttggcggtggcatcgccatc
aacggacagctcttctggggcatcgacggcaccgcgggcgagatcggccatctgaccatg
gacccagatgggccgctctgtacctgtggcaatcgcggttgtctcgaaacctatgccagt
ggggtggcgatccagaagctggcgatgcggcgtctggcggatgcgcctgacagcctgttg
ctgcagcttgccgacggcgacccgacgcgcgtcacgccagcgttggtcgggcaggctgcg
acaatgggcgacgcaacggcgcaatcgattctggcgcatgtgacgaaatatttgggcgtt
ggtgtggcgaacatagtcacaacgctcagcccagattgtgtggttctcggcggcagcgtg
gccaatctcggcgagcaactgctggcgccggtgcgcgccatcgtgcgcgagcgctgccgt
gccatcccggtcgaccgggtacgcatcgtgcaggcggagctgggtcccgacgccggcgcc
atcggtgcagcgttgtgggcgagacagcagggacgttga

DBGET integrated database retrieval system