KEGG   Caldilinea aerophila: CLDAP_30920Help
Entry
CLDAP_30920       CDS       T01797                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cap  Caldilinea aerophila
Pathway
cap00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cap01100  Metabolic pathways
cap01110  Biosynthesis of secondary metabolites
cap01130  Biosynthesis of antibiotics
cap01230  Biosynthesis of amino acids
Module
cap_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLDAP_30920 (trpC)
Enzymes [BR:cap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CLDAP_30920 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh QRPTase_C His_biosynth PcrB IMPDH
Motif
Other DBs
NCBI-ProteinID: BAM01132
UniProt: I0I794
Position
3843839..3844696
Genome map
AA seq 285 aa AA seqDB search
MKPSKLDLAKRQGEVLELIMAWKRQEVPRQMEIAPLAQVKAFARLAPPALDFAAALTAEP
GASLIAEVKRASPSKGVIAQEWDPEQIAETYARNGAAAISCLTDSRFFQGKLEYLTAIKE
RLREIGKAIPVLRKDFIYHEYQVYEARMAGADAILLIVGVLGDNDLRALRELAESLGMAA
LVEVHDEAETERALKSGAHIIGVNNRDLRTFQVDIETTGRLRKLIPPDAILVGESGIRTA
EDVERMAAMGCDAILVGETFCRLPQAQRAAKVREFVEAGRRLRRA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccatccaaactcgacctcgccaaacgccagggtgaggtgctggaactgattatg
gcctggaagcgccaggaggttcctcgccagatggagattgcacccctggcgcaggtcaag
gcgttcgcccgcctggctccgcctgcgctcgacttcgctgctgcgctgacggcagaaccg
ggcgccagcctgatcgccgaggtgaagcgcgccagcccgtccaaaggcgtcatcgctcag
gagtgggatccagagcagatcgctgaaacgtacgcgcgtaacggtgcagcggccatttcc
tgcctcaccgacagccgtttttttcaaggcaaactggagtatctgactgccatcaaggag
cgcctgcgcgagatcggtaaggcgattccggtgctgcgcaaagattttatctaccatgaa
tatcaggtgtatgaagcgcgcatggccggggctgacgccatcctgctcatcgtcggcgtg
ctgggggacaacgatctgcgcgcgctgcgcgagctggccgaaagcctgggcatggcagcc
ctggtggaggtgcatgatgaggccgaaacagaacgcgcgctcaaaagcggcgcgcatatc
atcggcgtcaacaaccgcgacctgcgcacttttcaggtggatatcgaaaccaccggccgg
ctgcgtaagctgattccgcccgatgcaattcttgtcggcgaaagcggaattcgcacggct
gaggatgtggagcgcatggcagcaatgggctgcgacgccatcctagtcggggagaccttt
tgcaggctgccgcaggcgcagcgcgcggcaaaagtgagagaattcgtcgaggcgggcagg
cgtttacggcgagcgtga

DBGET integrated database retrieval system