KEGG   Caldilinea aerophila: CLDAP_31540Help
Entry
CLDAP_31540       CDS       T01797                                 

Definition
(GenBank) putative threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cap  Caldilinea aerophila
Pathway
cap00260  Glycine, serine and threonine metabolism
cap00750  Vitamin B6 metabolism
cap01100  Metabolic pathways
cap01110  Biosynthesis of secondary metabolites
cap01120  Microbial metabolism in diverse environments
cap01230  Biosynthesis of amino acids
Module
cap_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLDAP_31540
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CLDAP_31540
Enzymes [BR:cap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CLDAP_31540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: BAM01194
UniProt: I0I7F6
Position
complement(3929778..3930926)
Genome map
AA seq 382 aa AA seqDB search
MCGKVYDPNRLLNLCHECGRPLLARYDLGKAALTMTKESLRTREASLWRYEEVLPVQNDW
AMLRLGEGWTPLHHARRLGESIGCPNTYIKDEGLNVTASFKARGLAMAVSRAYELGAREL
AIPSAGNAACALSAYAAAAGLPAHVFMPKDVPTLFQVECRELGANVTLVDGLINDCGVRV
REGVAAHGWFDVSTLKEPYRVEGKKTMGYELAEQMDWELPDVIIYPTGGGTGMVGMWKAF
DEMEKMGLIGSKRPRMVTVQSSGCAPIVRAFEQGAAHAELWQGAKTIADGLRVPIAIGDF
LILRAIRESGGIAVTVTDEEMLHYARVMGSKSGIFPAPEGAATLAAQVHLLEQGWIKPDE
HVVLFNTGSGLKYAHLWANMVK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcaaagtctatgacccgaaccgtctgctcaatctttgccatgaatgtggacgg
cctttgttggcacgctatgacctgggtaaggctgcgctgaccatgaccaaagaatcgctg
cgcacacgagaggcaagcctgtggcgctatgaagaggtgttgcccgtgcaaaatgactgg
gccatgctgcggctgggcgaagggtggacacctctgcatcacgcccggcgtttaggcgag
tccatcggctgtcccaacacatatatcaaagatgaaggtctaaacgttactgcctccttc
aaggcccgcggcctggcgatggcggtcagccgtgcctatgagctcggcgcgcgcgagctg
gccatccccagcgcaggcaacgccgcctgtgccctgagcgcctacgccgccgccgctggc
ctgcctgcgcatgtctttatgccgaaagacgtgccgacgctcttccaggtcgaatgtcgc
gagttgggcgccaacgtgacgctggtcgacgggttaatcaacgactgcggcgtcagagtg
cgcgagggcgtggccgcccatggctggttcgacgtcagcacgctcaaggaaccctatcgc
gtcgaaggcaaaaagacgatgggctacgagctggccgagcagatggactgggagctgccc
gacgtcatcatctacccgaccgggggtggcaccggtatggtcggcatgtggaaagccttc
gatgaaatggagaagatgggactgatcggctccaaacggccgcgcatggtcacggtacag
agcagcggctgcgcgccgatcgtgcgcgcctttgagcaaggcgcagcacatgccgagctc
tggcaaggcgccaaaaccatcgccgacgggctgcgtgtgcccatcgccatcggcgatttc
ctgattttgcgggccattcgggagagcggcggcatcgctgtcaccgtcaccgatgaagag
atgttgcactatgcgcgcgtcatgggctcgaaaagcggcatctttcctgctccggagggt
gctgccacgctggcggcgcaggtgcacctgcttgaacagggctggatcaagcctgacgag
cacgtggtacttttcaataccggcagcggtctcaaatatgctcatctgtgggcgaacatg
gtaaaatga

DBGET integrated database retrieval system