KEGG   Caldilinea aerophila: CLDAP_31850Help
Entry
CLDAP_31850       CDS       T01797                                 

Definition
putative 6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cap  Caldilinea aerophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLDAP_31850
   01230 Biosynthesis of amino acids
    CLDAP_31850
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLDAP_31850
   00030 Pentose phosphate pathway
    CLDAP_31850
   00051 Fructose and mannose metabolism
    CLDAP_31850
   00052 Galactose metabolism
    CLDAP_31850
  Energy metabolism
   00680 Methane metabolism
    CLDAP_31850
Enzymes [BR:cap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLDAP_31850
Protein phosphatases and associated proteins [BR:cap01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLDAP_31850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3972814..3975033
Genome map
AA seq 739 aa AA seqDB search
MTSGGDAQGMNAALRAVVRAGLDRGLEVYAIYEGYRGLVEGGELIRPMNWNSVGGILQLG
GTIIGTARCAEFRTREGRVRAVANLIRRGIDGLVVIGGDGSLTGADVLRSEWAGICQELL
SAGQISQAEFEAYPYLAIVGLVGSIDNDMWGTDITIGADSALHRITYAVDAISSTAASHQ
RTFVVEVMGRNSGYLALMSALATGADWVLIPESPPDVENWEEKMCQVLKAGRMAGRRDSI
VIVAEGAIDRNGAKITADYVRQVLEHHLHEDVRTTILGHVQRGGAPSAYDRTMSTLVGVA
AVDELLNTTAESTPQLIGVKGNRVTRLPLMECVEKTHALNAAIKECNFAKAMELRGRGFQ
ESFQILRTLVRALPHEPKVGQRRLTLAVLTASAPAPGMNTAVRAAVRLGLDRGHYMLGVN
NSFLGLINDDMRPFKWMDVDGWASMGGSELGTNRHVPSGRDLYAIARTIEERRIDGLLII
GGWAGYSSALRLMQERENFPAFEIPIICLPASINNNLPGSELSVGADTALNNIVDAVNKI
KQSAVASRRCFVVEVMGRYCGYLALMSMLATGAERAYLHEEGVTLKDLYEDVMLLNTGFE
HGKRLGVMIRNERAHPLYTTQFMANLFEAEGGDLYEVRTSVLGHLQQGGDPSPFDRILAT
RYAYRCINFLEEEALAGRNTVACVGVQGSRYHITPLEEVIRQYDTKHERPKEQWWMSLRP
VARMLAQPGPQYYQQRTES
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcggtggagatgcgcaggggatgaatgcagcattgcgtgcggtcgtgcgcgct
gggctcgatcgcgggctggaggtgtatgccatctacgaaggctatcgcgggctggttgaa
gggggcgagctgatccggccgatgaactggaacagcgtaggcggcattttgcagctcggt
ggaactatcatcggcacggcacgctgtgcggaatttcgcacgcgggaaggtcgcgtgcgc
gctgtcgccaacctgattcgccgcgggatcgacggcctggttgtcatcggcggcgacggc
agcctgaccggcgccgatgtcctgcgctccgaatgggcggggatctgccaggagctgctc
agtgccgggcagatcagccaggccgagtttgaagcctatccctatctggccatcgtgggg
ctggtcggctccatcgacaacgacatgtggggcacagacatcacgatcggcgcggacagc
gcgctgcatcgcatcacctatgccgtggacgccatcagcagcacggcggccagccaccag
cgcaccttcgtggtcgaggtgatgggacgcaattctggatatctggcgctgatgagcgcg
ctggcgaccggcgccgactgggtgttgatcccggaaagtccgcctgacgttgaaaactgg
gaagaaaaaatgtgtcaggtcttaaaggctggccgcatggccggacgacgcgacagcatc
gtcatcgtggccgagggggctatcgaccgcaacggcgccaaaatcactgcggactacgtg
cgccaggtgctggagcaccatctccatgaggatgtgcgcactacgattttgggacatgtg
cagcgcgggggcgcgccgagcgcctatgaccgcacgatgagcacgctggtgggcgtggcc
gctgtcgacgagctgctcaacaccacggcagaatcgaccccgcaactgatcggcgtcaag
ggcaaccgtgtgacgcgattgcccttaatggaatgcgtagagaagacccacgccctcaac
gcggccatcaaggaatgcaacttcgccaaagcgatggagctgcgcggtcgcggcttccag
gaatccttccagattctgcgcacgttggtgcgcgcgctgccgcatgagcctaaggtcggg
caacgacgactgacgctggctgtgctgactgccagcgcgcctgcaccgggtatgaacacc
gccgtacgcgcggcggtgcgtttaggcctcgatcgcggccattacatgttgggcgtcaac
aacagcttcctgggcctcattaacgatgacatgcgccccttcaaatggatggatgtcgat
ggctgggcgtcgatgggcggttccgaattaggtacaaaccgccatgttcccagcgggagg
gatctgtacgccatcgcgcgcaccattgaagaacgccggatcgatgggctgctcatcatc
ggcggctgggccgggtacagttcggcgctccgcctgatgcaggaacgggaaaatttcccg
gctttcgagatacccatcatctgtctgccggcttcgatcaacaacaacctgcccggcagc
gaactgagcgtcggcgccgacacggctctgaacaacatcgtggacgctgtcaacaagatc
aaacagtcggcggtggcctcgcgacgctgctttgtggtggaagtcatgggcagatattgc
ggttatctggcgctaatgagcatgctggccaccggcgcagagcgcgcctatctgcatgag
gaaggcgtcacgctcaaagacctctatgaggatgtgatgctgctgaacaccggctttgag
cacggcaaacggttgggggtaatgattcgcaacgagcgggcgcatccactctacacgacc
caattcatggcgaatctgtttgaggcagaaggaggcgatctgtacgaggtgcgcacttct
gtgcttggtcatctccaacagggcggcgacccctcgcccttcgaccgtatcctggccacg
cgctacgcctatcgctgcatcaactttttggaggaagaggcgctggctggacgcaacacc
gtcgcctgcgtcggcgtgcaggggagccgttatcacatcactcccctggaagaggtcatt
cgtcagtatgacacaaagcacgagagacccaaagaacagtggtggatgtcgttgcgccct
gttgcgaggatgcttgctcagccagggccgcaatactatcagcagcgtaccgaaagctga

DBGET integrated database retrieval system