KEGG   Caldilinea aerophila: CLDAP_31870Help
Entry
CLDAP_31870       CDS       T01797                                 

Definition
putative phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cap  Caldilinea aerophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cap01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cap01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cap00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cap00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cap00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cap00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cap00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3976783..3977877
Genome map
AA seq 364 aa AA seqDB search
MERAVDEGHEVIGIRRGWAGLLYLNPDDPETYDQCFIKLDKSKVRTIDRTGGTFLHTSRT
NPANVKPKDVPAFLRDPNRPETDDKARLDFTPHVLKNLEFLGIDRLIPIGGDDTLSFGER
LHSEGFPVIAIPKTMDNDVYGTDYCIGFGTAVTRSVQFIHQLRTSAGSHERIAVIELFGR
NSGETSLISSYLASVDRAIISEVPFDVEKLAELVMRDKRANPSNYAMVTISEGAHFIGGQ
VIEYGEADAYGHRKLGGIGMLTGEALKKLTGEDIIYQQLSYLMRSGAPDALDLMVAVNYA
NLAVSLITSGVSGRMVALRDGTYTHIPMSTVTSGVKRVDVGELYDVNEYRPKVRHVLGKP
MFLY
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtggagcgggcggtcgacgaaggccatgaggtgatcggtatccgccgtggctgggcgggt
ctcctctatctgaatccagatgacccggagacctatgatcagtgcttcatcaagctggac
aaaagtaaagtccgcacgatcgatcgcacaggcggaacctttctgcacaccagccgcacc
aatcctgccaacgtaaaacccaaagatgtcccggcgtttctgcgtgacccgaacagaccc
gagacagatgacaaagcgcggctcgattttacgccgcacgtgttgaaaaatttggaattc
ttgggcatcgatcgccttattccgatcggcggcgacgacaccctcagcttcggcgagcgc
ctgcacagcgaaggctttccggtgatcgccatccccaagacgatggataacgacgtatac
ggcaccgactattgcatcggctttggcacggctgtcacgcgcagcgtccagttcatccat
cagctccgcaccagcgccggctctcatgagcgcatcgccgtcatcgagctgtttggacgc
aacagcggtgagaccagcctgatcagctcctacctcgccagcgtggatcgtgccatcatc
tctgaggtacccttcgacgtggaaaaattggccgaacttgtcatgcgcgacaagcgcgcg
aatccgagcaactatgccatggtcaccatcagcgaaggcgctcacttcatcggcggtcag
gttatcgaatatggcgaggcagatgcctacggccatcgcaaactgggcggcatcggcatg
ctcaccggcgaagcgctcaaaaagctgaccggcgaagacatcatctatcagcagctctct
tacctgatgcgctccggcgcacccgatgcgctcgacctgatggtggctgtcaactatgca
aacctggccgtgtcgctcatcaccagcggcgtcagcggccggatggtggcgctgcgtgac
ggcacctacacgcacatcccgatgagcaccgtcaccagcggtgtgaagcgcgtcgacgtg
ggcgaactctatgatgttaacgagtatcggcccaaggtgcgccacgtgctcggcaaaccg
atgttcctgtattga

DBGET integrated database retrieval system