KEGG   Caldilinea aerophila: CLDAP_31870Help
Entry
CLDAP_31870       CDS       T01797                                 

Definition
putative phosphotransferase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cap  Caldilinea aerophila
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLDAP_31870
   01230 Biosynthesis of amino acids
    CLDAP_31870
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLDAP_31870
   00030 Pentose phosphate pathway
    CLDAP_31870
   00051 Fructose and mannose metabolism
    CLDAP_31870
   00052 Galactose metabolism
    CLDAP_31870
  Energy metabolism
   00680 Methane metabolism
    CLDAP_31870
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CLDAP_31870
Enzymes [BR:cap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLDAP_31870
Protein phosphatases and associated proteins [BR:cap01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLDAP_31870
Messenger RNA biogenesis [BR:cap03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CLDAP_31870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3976783..3977877
Genome map
AA seq 364 aa AA seqDB search
MERAVDEGHEVIGIRRGWAGLLYLNPDDPETYDQCFIKLDKSKVRTIDRTGGTFLHTSRT
NPANVKPKDVPAFLRDPNRPETDDKARLDFTPHVLKNLEFLGIDRLIPIGGDDTLSFGER
LHSEGFPVIAIPKTMDNDVYGTDYCIGFGTAVTRSVQFIHQLRTSAGSHERIAVIELFGR
NSGETSLISSYLASVDRAIISEVPFDVEKLAELVMRDKRANPSNYAMVTISEGAHFIGGQ
VIEYGEADAYGHRKLGGIGMLTGEALKKLTGEDIIYQQLSYLMRSGAPDALDLMVAVNYA
NLAVSLITSGVSGRMVALRDGTYTHIPMSTVTSGVKRVDVGELYDVNEYRPKVRHVLGKP
MFLY
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtggagcgggcggtcgacgaaggccatgaggtgatcggtatccgccgtggctgggcgggt
ctcctctatctgaatccagatgacccggagacctatgatcagtgcttcatcaagctggac
aaaagtaaagtccgcacgatcgatcgcacaggcggaacctttctgcacaccagccgcacc
aatcctgccaacgtaaaacccaaagatgtcccggcgtttctgcgtgacccgaacagaccc
gagacagatgacaaagcgcggctcgattttacgccgcacgtgttgaaaaatttggaattc
ttgggcatcgatcgccttattccgatcggcggcgacgacaccctcagcttcggcgagcgc
ctgcacagcgaaggctttccggtgatcgccatccccaagacgatggataacgacgtatac
ggcaccgactattgcatcggctttggcacggctgtcacgcgcagcgtccagttcatccat
cagctccgcaccagcgccggctctcatgagcgcatcgccgtcatcgagctgtttggacgc
aacagcggtgagaccagcctgatcagctcctacctcgccagcgtggatcgtgccatcatc
tctgaggtacccttcgacgtggaaaaattggccgaacttgtcatgcgcgacaagcgcgcg
aatccgagcaactatgccatggtcaccatcagcgaaggcgctcacttcatcggcggtcag
gttatcgaatatggcgaggcagatgcctacggccatcgcaaactgggcggcatcggcatg
ctcaccggcgaagcgctcaaaaagctgaccggcgaagacatcatctatcagcagctctct
tacctgatgcgctccggcgcacccgatgcgctcgacctgatggtggctgtcaactatgca
aacctggccgtgtcgctcatcaccagcggcgtcagcggccggatggtggcgctgcgtgac
ggcacctacacgcacatcccgatgagcaccgtcaccagcggtgtgaagcgcgtcgacgtg
ggcgaactctatgatgttaacgagtatcggcccaaggtgcgccacgtgctcggcaaaccg
atgttcctgtattga

DBGET integrated database retrieval system