KEGG   Caldilinea aerophila: CLDAP_32240Help
Entry
CLDAP_32240       CDS       T01797                                 

Definition
putative alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
cap  Caldilinea aerophila
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cap00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cap00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cap00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4026029..4027264)
Genome map
AA seq 411 aa AA seqDB search
MSFGLSMFRDLFSTQDLKGSELVLVDIDPEYLERMYQLALLMNERSGAGLKISRTLNRRE
ALPGTGFVVNSIALERTRLWKLDFEIPKKHGVRHTLGENGGPGGLFFTLRTIPIIMDIIR
DMEELCPNALFINFSNPESRIIYALGKYSRIQAIGLCHGVFMGRNDVARIMGLPAEEVDV
WAAGLNHFQWFLQIRHRLTGEDLYSLLREKEKTYDPAFMPLSRRLFRAFGLYPSCSDDHI
GEYLAYGWEAGEEGYDFDKDEHYRVWLKTTIDGVLGGAEPPADFFLPSGERGVAVITGIL
HNQKRWIESGVVYNRGAIDNLPEDCAVEVPVVVDAHGVHPCAVGNLPAGIAALCSVQAHI
QQISVEAAMRGSKELALQALLIDPVIHSARAAEQILDELWEINRPYIRAML
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttggcttgagcatgttccgcgatttgttcagtacccaggatcttaaaggcagt
gaactggtgctggtggatattgatcctgaatatctggagcgcatgtaccagctggcgcta
ctgatgaatgagcgcagtggcgccgggttgaaaatttcccgcacgttgaaccgccgcgaa
gccctgcccggaacagggtttgtggtgaacagcattgctctggaacggacccgtctgtgg
aaactggattttgaaattcccaaaaagcatggtgtgcggcacaccctgggagaaaatggc
ggtcctggcggattgttctttaccctgcgcaccatccccatcattatggatatcattcgg
gacatggaagaactgtgccccaacgccctgtttatcaacttttccaatccagaaagccgc
atcatctatgcgctgggtaagtacagtcggattcaagccatcggtttgtgccatggggtc
ttcatgggacgcaatgacgtcgcccgcatcatgggattgcctgcggaagaagtagatgta
tgggcggcaggcttgaatcatttccagtggttcctgcagatccgtcaccgtctgacgggt
gaagacctctactcgctcctgcgggaaaaagagaagacctatgaccctgcctttatgccc
ttgagccgtcgtctcttccgtgcctttggtttgtatccatcctgttcggatgaccatatt
ggcgaatatctggcatatggctgggaagcgggagaagagggctatgattttgataaggac
gaacattatcgggtgtggttaaaaacaaccattgacggcgttctgggcggtgccgaaccg
ccggcggattttttcctgccttcgggcgagcgcggcgttgccgtgataaccggcatccta
cataatcagaagcgctggattgagtcgggtgtggtgtacaaccgcggcgctattgataac
ctgccggaggattgcgcagtggaagtgccggtggtggtggacgcgcatggggtgcatcct
tgcgctgtgggaaacctgcccgcagggattgctgccctgtgcagtgtgcaagcccatatt
cagcaaatcagcgtagaagccgccatgcgcggctcaaaagaactggcattgcaggcatta
ttgattgatccggtgattcattctgccagagccgccgagcaaattctggacgagttgtgg
gagatcaaccgaccctacattcgtgctatgctatga

DBGET integrated database retrieval system