KEGG   Caldilinea aerophila: CLDAP_34490Help
Entry
CLDAP_34490       CDS       T01797                                 

Definition
putative UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cap  Caldilinea aerophila
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CLDAP_34490
   00052 Galactose metabolism
    CLDAP_34490
   00500 Starch and sucrose metabolism
    CLDAP_34490
   00520 Amino sugar and nucleotide sugar metabolism
    CLDAP_34490
Enzymes [BR:cap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CLDAP_34490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4298690..4299553
Genome map
AA seq 287 aa AA seqDB search
MIVKKAVITAAGRRQRTLPLQTLIDRDGTEKSVLSILIEEVLAAGIDEIAVVVRPGDEQA
YAQVAGDHVRRLVFVHQPEPLGHGHAVYCARGFAGSDAFLHLVGDHLYVSANAQRCAQAL
VAMAQTQECAISAVQPTRESLLPYYGAVGGRRVSGAVGLYEIDTVIEKPTPTQAEQRLIV
PGLRAGYYLCFFGMHVLTPTVMSILDAQIAAGAPADHPERGFTLSAALVELAQREKYLAL
ELAGSRYDVGVKYGLLTAQLALALTGDDREEVLTRLLELLAQRELNR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgattgtcaaaaaagccgtcatcactgctgcaggtcgcagacaacgcactttgccgctc
cagacactgatcgaccgcgacggcaccgaaaaatcagtgctatccatcttgatcgaagaa
gtgctggcggccggcatcgacgagatcgccgtcgtggtgcggcctggagacgagcaggca
tatgcgcaggtggcgggtgatcatgtgcgccggctcgtctttgttcatcagcctgaaccg
ttggggcacggacacgccgtctactgtgcgcgagggtttgcaggcagcgacgcctttctg
caccttgtgggcgatcatctctacgtcagcgccaacgcgcaacgctgcgcgcaggcgctg
gtggcgatggcgcaaacgcaggagtgtgccatctccgccgtgcagccgacgcgcgagagt
ctgctgccatactatggggcagtcggaggccgtcgcgtctccggcgccgtcggcctttat
gagatcgacaccgtcattgaaaagcccactcccacgcaggccgagcagcgcttgatcgtg
ccggggctgcgtgcaggctattacctctgtttctttgggatgcacgtgctgacgcccacg
gtgatgagcatcctcgacgcacagatcgctgcaggtgcgcccgccgaccacccagaacgc
ggcttcacgctctcggcagcgttggtggagctggcgcagcgcgagaaatatctggcgctc
gagctggcaggcagccgctacgacgtcggcgtcaagtatgggttgctcaccgcacaactg
gcgctggcgctcaccggcgacgaccgcgaagaggtgttgacgcggctgctcgaactgttg
gcgcagcgagagctgaatcgatga

DBGET integrated database retrieval system