KEGG   Caldilinea aerophila: CLDAP_35110Help
Entry
CLDAP_35110       CDS       T01797                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cap  Caldilinea aerophila
Pathway
cap00010  Glycolysis / Gluconeogenesis
cap00030  Pentose phosphate pathway
cap00051  Fructose and mannose metabolism
cap00052  Galactose metabolism
cap00680  Methane metabolism
cap01100  Metabolic pathways
cap01110  Biosynthesis of secondary metabolites
cap01120  Microbial metabolism in diverse environments
cap01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLDAP_35110 (pfkA)
   00030 Pentose phosphate pathway
    CLDAP_35110 (pfkA)
   00051 Fructose and mannose metabolism
    CLDAP_35110 (pfkA)
   00052 Galactose metabolism
    CLDAP_35110 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CLDAP_35110 (pfkA)
Enzymes [BR:cap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLDAP_35110 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CLDAP_35110 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DUF4407 Sorting_nexin PDDEXK_9
Motif
Other DBs
NCBI-ProteinID: BAM01551
UniProt: I0I8G3
Position
complement(4385655..4386722)
Genome map
AA seq 355 aa AA seqDB search
MGKAAIGTYGMQIIGFRDGFRGLMQDRTVRLTGAELSGILTVGGTILGTSRDKPHKMPVG
DQTMDMTNVMLETYRRHHLDALVCLGGGGTQKNAYHLAKHGMNIITLPKTIDNDVSGTDV
TFGFDTALGIATEAIDRLHSTAHSHHRIIVVELMGHNAGWLALGAGIAGGADVILLPEIP
YDVEVVAEAIRQRQRRGSGFSIVAVSEGAHSRQDAEVLAKANAELVEAKKENDKKKKKQA
KEKLAQLTQRMQDKTLRLSRKLEELTGLESRVTILGHLQRGGTPSAADRLLATRLGTACA
ELIHKGVFGVMVAARGDCAEPVPLEDVVGKVKLVPPDHPWIQTARDIGVCLGDRL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgggaaaggctgcaatcggcacctatggcatgcaaattatcggatttcgagacggcttt
cgcggccttatgcaggatcgcactgtgcggctcaccggtgcagagctgtcgggtatcctt
accgtgggtggcacgatccttggcaccagccgcgacaagccacataagatgccggtaggt
gaccagaccatggacatgaccaacgtaatgctggagacctatcgccgtcaccatctggac
gcgttggtctgtctgggcgggggcggcacgcaaaagaacgcctaccatctcgccaaacat
ggtatgaacatcatcaccctccctaaaaccatcgataacgacgtcagcggcaccgacgtg
acctttggtttcgacacggcgctgggcatcgctaccgaggcaatcgaccggctgcacagc
actgcccacagccatcatcgcatcattgtggtggagctgatgggacacaacgccggctgg
ctggcgctaggcgcaggtattgcgggcggcgccgacgtcatcttgcttcctgagatccct
tacgatgtggaagtcgtggcggaggcgatccgacagcgccaacgtcgtggcagtggcttt
agcatcgttgcggtctccgaaggcgcacattcccggcaggatgcagaggtattagcgaag
gcaaacgctgaactggtcgaggccaagaaggaaaatgacaagaaaaagaagaagcaggcc
aaggaaaaactcgcccaattgactcagaggatgcaggacaaaaccctccgtctctctcgc
aaattggaagagctgacaggattggaatcgcgtgtgaccatcctgggtcatctccaacga
ggaggcacgccatctgctgcggatcgcctgttggccacgcgactcggcaccgcctgcgca
gagttgattcacaagggtgtctttggggtcatggtggcagcgcgcggagattgtgctgaa
ccggtgccattagaagatgtggtgggcaaggtgaaacttgtaccaccggatcatccctgg
attcaaacggcgcgtgacatcggcgtttgcctgggagataggttgtag

DBGET integrated database retrieval system