KEGG   Caldilinea aerophila: CLDAP_35960Help
Entry
CLDAP_35960       CDS       T01797                                 

Definition
putative NagC family transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cap  Caldilinea aerophila
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLDAP_35960
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLDAP_35960
   00052 Galactose metabolism
    CLDAP_35960
   00500 Starch and sucrose metabolism
    CLDAP_35960
   00520 Amino sugar and nucleotide sugar metabolism
    CLDAP_35960
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CLDAP_35960
   00524 Butirosin and neomycin biosynthesis
    CLDAP_35960
Enzymes [BR:cap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CLDAP_35960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4491819..4492823
Genome map
AA seq 334 aa AA seqDB search
MDPLSRNPEHTSSACWLVGVDIGGTTVSTVLLDECLRPHGELTVPTDLSSPDATMWCVVS
AIEQTVALGDASRRLAAIGLGIPGQQDYEQGIVRIAVNLRWYDYPLIPRLTEHFGVPCAF
ENDVRAAALGVYRFDNPNGDQSIAYVSIGTGLAVGVILDGRLVRGRHGLAGEFGHMIIDP
NGPLCNCGTRGCLETLVSATAVVRRAKEAIAQGAGGALAALEAITARAVYEAATAGDDVA
QRIVDEVGVELARALRSVVLAYDVDGVVLGGGVTRAGERYLRPILAEWQRQRESSALARA
VLRPEILRIADPTRNLGAWGAAALAADLMSRPGS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggatccgctctcacgaaatcctgagcatacttcctctgcctgctggctggtcggcgtt
gatattggcggcaccaccgtgtcaaccgtgcttctcgacgaatgcctgcgcccccacggt
gaactgaccgtccccaccgatctcagcagcccggacgccaccatgtggtgcgtcgtatct
gccatcgagcagactgtagcgctgggcgatgcgtcccgtcgcctggctgccatcgggcta
ggcatccctggccaacaggattatgagcaaggcatcgtgcgcatcgctgtcaacctgcgc
tggtacgactatccactgattccccgtctcaccgaacactttggcgttccttgcgccttc
gagaacgatgtgcgcgctgccgctcttggcgtctatcgcttcgacaatccgaacggtgac
cagagcattgcgtacgtcagcatcggcaccggccttgccgtcggcgtgatcctggatggc
aggctggtgcgcggccgtcacgggttggccggcgagttcggccatatgatcatcgatccg
aatggtccgctctgcaactgcggcacgcggggctgtctggagacgctcgtttcggcaacc
gcggtcgtgcgtcgggcaaaagaagcgatcgcacagggggccggcggggcgctggctgcg
ctggaggccatcacggcgcgcgcggtttacgaggcagcgactgcgggcgatgatgtggcc
cagcgcatcgtcgatgaggtaggcgtggagctggcgcgggcactgcgcagcgtggtgttg
gcctacgacgtcgatggcgtcgtgctcggcggcggcgtgacgcgcgccggcgaacggtat
ttgcgccccatcctggccgaatggcagcggcaacgagaaagctctgcattggcgcgcgcc
gtgctgcgacctgaaattctgcgcattgccgaccccacgcgcaatctcggggcgtggggt
gcagccgcgctggctgccgatttgatgagccgcccaggcagctaa

DBGET integrated database retrieval system