KEGG   Caldilinea aerophila: CLDAP_37070Help
Entry
CLDAP_37070       CDS       T01797                                 

Gene name
treZ
Definition
malto-oligosyltrehalose trehalohydrolase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cap  Caldilinea aerophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CLDAP_37070 (treZ)
Enzymes [BR:cap01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     CLDAP_37070 (treZ)
Exosome [BR:cap04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLDAP_37070 (treZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4630064..4631887)
Genome map
AA seq 607 aa AA seqDB search
MSARLADLFQRAVTDERLPDDLRGGAHRDLIKRGTVTFVMRAPFKPFVSLVGDFNHWDTR
SHPMQTDGQGTWWITIPDPGRTRYGFYVVVDEDSHVWVGDPYAREVFWGQKTPWAVLPGP
EAPFPWHDQAWRTPALRDLIIYELCVRDFAGAWHGGYPQYGSFERLTRQLPYIVGLGVNC
IELMPINAFPGESSWGYNPVFYHAVANTYGGPNDFKRFVDACHRAGIAVILDVAFNHAWG
QHPYYQIYPPMYGPKGEWLTDWNPFFHHTPPSINMWGGVDWDHFNPETTRYFQDIVRFWL
EEYHIDGFRFDWVGGVDYDSNNPMQPDFNPYHGIAAICWAARQAKPDSILIGEFWQLEGT
SPEKTAARLVHETEMDAVWNGYFHHTLDDVLNCRWEWEKRDIFRTIGGYRDLGFSTATQV
VNYSCSHDEVRPEHEIKFHSGRYIPQPPGMTLQDVALARAKLGLVAVFAAPGVPMIYAGQ
EYGDDSPRTIDFAPLQWSKLTRPKHRRHLEMTKRLIRARRQHAALRSDLIRFFDNHFPTE
QVVRFCRWDDAGDYAVCALNFSPEPRTVELPVPRDGFWRDVVGNRRHVAQDGRIVMELGP
YDAALFV
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccgacttgcagacctattccagcgtgccgtcaccgacgaacggctgccagac
gacctgcgcggaggcgctcatcgcgacctcattaagcgagggacggtcacctttgtgatg
cgcgcgccctttaaaccgttcgtcagcctggtcggcgattttaaccactgggacacgcgc
agccatccaatgcagactgacggccaggggacatggtggatcacgattcccgacccgggg
cgcacgcgctatgggttctacgtcgtggtggatgaagattcgcacgtctgggtaggcgac
ccctacgcccgcgaggtcttctggggacaaaagacgccatgggcggtgcttcccggtcct
gaggcacctttcccctggcatgatcaggcgtggaggacgccagcgttgcgcgatctgatc
atctatgaactttgcgtccgcgacttcgccggcgcctggcatggaggctatccgcagtac
ggcagctttgaacggctgacacgacaactgccctacatcgtcggcctgggcgtgaattgc
atcgagttgatgccgatcaatgcttttccaggcgaatcgagctgggggtataaccctgtc
ttctaccacgctgttgcgaacacctacggtggtcccaatgacttcaagcgcttcgtagac
gcctgtcatcgcgccgggatcgctgtcattctggacgtcgccttcaaccatgcctggggg
caacacccttactatcagatttacccgccgatgtacggcccgaagggtgaatggttgact
gactggaatcccttttttcaccacacgccgccgagcatcaacatgtggggcggagtggat
tgggatcacttcaacccggagaccacacgctattttcaggatatcgtgcgcttctggctg
gaggaatatcacattgacggcttccgcttcgactgggtgggcggcgtcgattacgacagc
aacaacccgatgcagccggactttaatccctaccatggcatcgccgccatctgctgggcg
gcgcggcaggccaagccagatagcatcctgattggtgaattctggcaactggagggaacc
agcccggaaaagactgccgcacgactggtgcacgagaccgagatggacgccgtgtggaac
ggctactttcatcacacgctggacgacgtgctcaactgccgttgggagtgggaaaagcgc
gatatcttccgcaccatcggcggctaccgcgatctgggcttcagcacggccacgcaggtc
gtgaattattcgtgcagccacgacgaggtacggccggagcatgagatcaaattccactct
ggcagatacatccctcagccgccggggatgacgcttcaggatgtggcgctggcgcgggcg
aaattggggctggtggccgtcttcgctgcgcctggggtgccgatgatctacgccgggcag
gagtacggtgacgacagcccccgcaccatcgactttgcaccgctccagtggagcaaattg
acgcggcccaaacaccgtcgacacctggagatgaccaagcggctgatccgggcaagacga
cagcacgccgcgttgcgcagcgacttgattcgcttcttcgacaatcactttcctaccgaa
caggtggtgcgcttctgccgttgggatgatgcaggagactatgcagtctgtgctctcaac
ttctcccccgagccgcgcactgttgagctgcccgtcccgcgcgatggtttctggcgagat
gtcgtaggcaaccgtcgccacgtcgcccaagatggccgaatcgtgatggagctggggcca
tatgatgccgcgctcttcgtgtga

DBGET integrated database retrieval system