KEGG   Caldilinea aerophila: CLDAP_37300Help
Entry
CLDAP_37300       CDS       T01797                                 

Definition
putative zinc-containing alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cap  Caldilinea aerophila
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CLDAP_37300
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLDAP_37300
  Lipid metabolism
   00071 Fatty acid degradation
    CLDAP_37300
  Amino acid metabolism
   00350 Tyrosine metabolism
    CLDAP_37300
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CLDAP_37300
   00626 Naphthalene degradation
    CLDAP_37300
Enzymes [BR:cap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CLDAP_37300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4662590..4663606)
Genome map
AA seq 338 aa AA seqDB search
MRAMQLFQTGDIAEDRLFLAEDVPVPQPGSGELRVRVHACGVCRTDLHTVEGDLALPRPL
PLIPGHQVVGVVDAVGEQVTRIAVGDRVGVGWMNWTCGVCDFCRRGRENLCPSARFTGLH
QDGGYAEWMVVHERFAYRLPEGLSDQAAAPLLCGGVIGYRTLRLSGIERGGRLGLYGFGA
SAHQAIQVARHWGCEVYVFTRGEEHRRLAEALGAIWVGDANEQPPHPLDAAAIFAPAGWI
VERALRHVRPGAVVAINAIHMTPIPELPYERIYGERVLRSVANFTRQDAEEFLALAAAIP
VRTEVETFSLAEANHALRRLKQGALRAAAVLNIDDPDH
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccatgcaactttttcaaaccggagacatcgccgaggatcgcctgtttttagcc
gaagacgtgccggtgccgcagcctggctcgggcgaactgcgcgtgcgcgttcatgcctgc
ggcgtctgtcgcaccgatctgcacacggtcgaaggcgatctggctctgccgcgacccctt
cctctgattcccggccatcaggtcgttggcgttgtggacgccgtcggtgaacaggtaacg
cgcatcgccgtcggcgatcgcgtcggcgtgggctggatgaactggacctgcggcgtatgc
gatttttgtcggcgcggccgggagaatctttgcccttctgcgcgcttcaccggcctgcat
caagatggcggctacgccgagtggatggtcgtgcacgaacgcttcgcctatcgactgccc
gaggggttatctgaccaggcggccgcgccgctgctctgtggcggcgtgatcggctatcgc
acccttcgcctgagcggcattgagcggggaggccgcctggggttatatggcttcggcgcc
agcgctcaccaggcgatccaggttgcccggcattgggggtgcgaagtgtacgttttcacg
cgcggggaggaacatcgccgcctggccgaggcgttgggtgcgatttgggtgggtgatgca
aatgaacagcctcctcatccgctggatgccgctgcgatctttgctcccgccggttggatc
gtagagcgggcgctgcgtcatgtgcgtcccggcgccgttgtggcaatcaacgccatccac
atgacacccattccagagctcccttacgagcgcatctatggggagcgagtgttgcgcagc
gtcgccaacttcacccggcaggatgccgaggaattcctggcgctggcagcagcgatcccg
gtgcgcaccgaggttgagaccttttccctggccgaggccaatcatgccctgcgacggctc
aagcaaggcgcgctgcgcgccgccgctgtcctgaacattgatgatcctgaccattaa

DBGET integrated database retrieval system