KEGG   Caldilinea aerophila: CLDAP_38260Help
Entry
CLDAP_38260       CDS       T01797                                 

Definition
helicase RecD/TraA family protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
cap  Caldilinea aerophila
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cap00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CLDAP_38260
Enzymes [BR:cap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CLDAP_38260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4796996..4799344)
Genome map
AA seq 782 aa AA seqDB search
MDTLRGVVERITFHNEENGYTVAKLTPEAGAWQHHAPASFGAAREVTIVGNMLGLNVGEC
VELQGRWTVHSDYGRQFQVETFRPVLPATIAGLEKYLGSGLIKGVGPVTAHRIVKQFGLD
TLTIIEEQPERLVEVPGVGPKRMELIRKAWLEQRAIKEVMLFLQSHGVSTSLATKIYKTY
GDDAIQIVRSDPYRLARDIFGIGFLTADKIAQSLGMPEDAPERAAAGIAYALNQASEEGH
VFLPTSELVKQAAELLGLSPALIGMGLARLWNEGQVKVAPGPGGEAIEPQPSFVAEPRLV
AEQGQLYAVRTVEEAQQLLAEEHAVYLTSLYFSEVGTARHLYRLLREGESRLAVFARYRP
ADWSRVLKEAERSSGFPLAPQQQQAVQAVLTHRITVLTGGPGTGKTTTVRTIIELCRHEH
KRVLLAAPTGRAAKRLAETTGQEAKTIHRLLEFKPGEGLAFQRNEGNPLDGDLLIVDEAS
MLDLPLTHHLLKAIPPGMHLLLVGDIDQLPSVGVGNVLKDIIAALESKEAPAGRAAVIRL
QTIFRQKAGSLIIANAHRINAGQMPIIDNSAATDFFLFRTEMPERAAELCVELVTERIPR
RFGIPPEEIQVLAPMHRGVAGVAALNAALQRALNPPGPDHPERTIGSRVYRVGDRVMQIR
NNYDKDVYNGDIGRIAALDPIFHTVTVVFDGRPVRYEFLELDELTHAYAISVHKSQGSEF
TAVVIPILTSHYMMLQRNLLYTAVTRARRLVVLVGQPRAIAMAVNNNTVTARYTGLKERL
LA
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggatacgctgcgcggcgtcgttgaacgcatcacctttcataacgaagagaacggctac
accgtcgctaaactgacgccagaagcaggggcgtggcagcatcacgcccctgcgagcttt
ggcgcagcgcgcgaggtgacgatcgtcggcaacatgctgggactgaacgtcggggagtgc
gtcgaactgcaagggcgctggacggtgcacagcgattacggccgtcagtttcaggtcgaa
acgttccgccccgtgctccctgccaccatcgccggcctggaaaagtatctgggcagtgga
ttgattaaaggcgtgggcccagtgaccgcccaccgcatcgtcaaacaattcggccttgac
acgttaaccatcatcgaggagcagccggaacggttggtcgaagtgccgggcgttgggccc
aagcgcatggagctgattcgcaaggcgtggcttgagcagcgtgccatcaaagaggtgatg
ctcttcctgcagagccatggggtcagcaccagccttgccaccaagatttacaagacctac
ggcgacgacgccattcaaatcgtacggagcgacccctatcggctggcgcgcgatattttc
ggcatcggtttcctgaccgccgacaagattgcgcagtcgttgggtatgccggaagatgcg
ccggagcgcgcagccgcgggcatcgcctacgcgctgaaccaggcgagcgaggaaggacat
gtctttcttccaacctcagagctggtgaagcaggcagcggaactgttgggcctctctccc
gccctgatcggcatggggctggcgcgcctgtggaacgagggtcaggtcaaggtggcacct
ggacccgggggcgaggccattgagccgcagccgtcctttgtcgccgagcccaggctggtt
gctgagcaaggtcagttgtacgctgtccgcaccgttgaagaggcgcagcaactgctcgcc
gaagagcatgccgtctatctgacatccctctatttcagtgaggttggcaccgcccgccat
ctgtaccgtctcctgagagaaggagaaagccgattggcggtcttcgcccggtatcgtccg
gccgattggagccgtgtgttgaaggaggctgagcgcagcagtggatttccgctcgctcct
caacagcaacaagctgtgcaggctgtattgacccatcgcatcacggtgctgacaggtggg
ccgggcaccggtaagacgacgaccgtgcgcacgatcatcgagctgtgtcggcatgagcac
aagcgcgtgttgctcgctgcgccaaccggccgtgccgccaaacgcctggcagaaacgacc
ggtcaggaagctaaaacgatccatcgcctgctggagtttaagccgggcgaggggctggct
ttccaacgcaacgaaggaaatccgctcgacggcgatttactgatcgtcgacgaagcctcc
atgctcgatctgccgctgacgcatcatttgttgaaggccatcccgcctggcatgcatctg
ttgctggttggcgatatcgatcagttaccaagtgtgggcgtgggtaacgtgctcaaggac
atcatcgccgcactggaaagcaaagaggcacctgcgggtcgcgcggctgtgattcgcctg
caaacgatttttcgtcagaaggccggttcgctgatcatcgccaacgcgcatcgtattaac
gcgggacaaatgccgatcatcgataacagcgcagcgactgatttttttctttttcgtaca
gaaatgccggagcgcgcagccgagctctgcgtggaacttgtaacggaacgcattccgcga
cgcttcggcattccgccggaagagatccaggtgctggcgccgatgcatcgcggggtggcc
ggcgtggcagcgctcaacgctgcgctgcaaagggcgttgaatccgccgggaccggatcac
cctgagcgcacgatcggcagccgcgtctatcgcgtcggcgaccgggtgatgcagattcgc
aataattacgataaggacgtctacaacggcgacatcggccgcatcgctgccctcgatccg
atcttccatacggtgaccgttgtgttcgatggccggccggtgcgttatgaatttcttgaa
ctggacgagctcacccatgcttacgccatcagcgttcacaaaagccagggtagtgagttt
accgccgtggtgatccccatccttacctctcactacatgatgctgcagcgcaacctgctc
tacactgcagtcacgcgagcgcggcggctggtcgtgctggtcggacagccgcgtgcgatc
gcaatggctgtgaacaacaacaccgtcacagcgcgctatactggtctgaaagagcgtttg
ctcgcttga

DBGET integrated database retrieval system