KEGG   Caldilinea aerophila: CLDAP_39190Help
Entry
CLDAP_39190       CDS       T01797                                 

Gene name
bkdB
Definition
branched-chain alpha-keto acid dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cap  Caldilinea aerophila
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLDAP_39190 (bkdB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLDAP_39190 (bkdB)
  Amino acid metabolism
   00310 Lysine degradation
    CLDAP_39190 (bkdB)
Enzymes [BR:cap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CLDAP_39190 (bkdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4918308..4919573
Genome map
AA seq 421 aa AA seqDB search
MATVVRMPQLGESVVEGTILRWLKQPGDPIVKNEPLLVISTDKIDTEVPAPADGVLLEVR
AEEGATVSAGSVIATIGEPGEQPQRPAEKETPAEPKHPGQSPDAGRSPALSPQAEDRPAG
RNFISPVVARMSAEHGIDLSKVTGTGLGGRITKKDLEAYLAGVRREVAEGEEGASEQAAA
PTTLGEDDVLQPLTAMRRAIAQHMVLSKRTSPHVTTICEVDMTNVVRHREANKRAYTRDG
AVLTYTAYFIVAAVAGLRAVPEANSRFTDAGIILHRRIHIGVAVALPDGLLVPVIRNADE
LSLAGIARTLNDLVNRTRNGLLKPDEVQGGTFTITNHGTGGSLFATPIINQPQSGILGVG
AIVKRPVVRSASSSLLPSADDVIAIRPMCYLSLTFDHRVMDGAQGDRFLTVVKQTLENWE
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggtcgtcaggatgccgcagctcggtgagagcgtcgtcgaaggcacgatctta
cgctggctgaaacagccaggcgatccgatcgtcaaaaacgagccgctgctggtcatcagc
acggacaaaatcgacaccgaagtgcctgcgccagcagacggggtattgcttgaagtaagg
gccgaagaaggcgccactgtatctgcaggctccgtgatcgccaccatcggcgagccggga
gagcaaccgcaacgacctgcagaaaaagaaacgccagcagagccaaagcacccaggccaa
tcgccggatgccggacgttcgcctgctctctcgcctcaagcggaggaccgaccggccgga
cgcaactttatcagcccggtggtggcacgcatgtccgccgagcacggcatcgatctgtca
aaggtcacaggaacgggccttggagggcgcatcaccaaaaaagacctcgaagcctatctt
gccggtgtacgccgcgaggtcgcagaaggtgaggagggagccagcgaacaggcggccgcg
ccgaccaccctcggcgaggatgatgtgctgcagccgttgactgccatgcgtcgtgccatc
gcgcaacacatggtgttgagtaaacgcaccagcccccacgtcaccaccatctgcgaagtg
gacatgaccaacgtcgtgcgccatcgcgaggctaacaagcgcgcctacacgcgcgatggc
gccgtgctcacctatacagcctacttcattgtggccgccgtggccggactgcgcgccgtg
ccggaagccaacagccgctttacggacgcaggcatcattctgcatcgccgcatccatatc
ggcgtggccgtggcgcttcccgacggcctgctcgtccctgtgattcgcaacgccgacgag
ttgagcctggccggcatcgcgcgcacgctcaacgatctggtcaaccgcacgcgcaacgga
ttgctcaaaccggacgaagttcaaggcggcacctttacgatcaccaatcatggcacgggt
ggcagcctctttgccacgccgattatcaatcaaccgcaaagcggcattcttggcgtcggc
gccatcgtcaagcggccggtcgtgcgcagcgccagctcttcgctccttcccagcgccgac
gatgtgatcgccatccggccgatgtgctacctcagcctcaccttcgatcatcgggtaatg
gatggggcgcagggcgacagatttttgacagtggtaaagcaaacattggaaaattgggaa
gcatag

DBGET integrated database retrieval system