KEGG   Caldilinea aerophila: CLDAP_39190Help
Entry
CLDAP_39190       CDS       T01797                                 

Gene name
bkdB
Definition
branched-chain alpha-keto acid dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
cap  Caldilinea aerophila
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLDAP_39190 (bkdB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CLDAP_39190 (bkdB)
  Amino acid metabolism
   00310 Lysine degradation
    CLDAP_39190 (bkdB)
Enzymes [BR:cap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CLDAP_39190 (bkdB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4918308..4919573
Genome map
AA seq 421 aa AA seqDB search
MATVVRMPQLGESVVEGTILRWLKQPGDPIVKNEPLLVISTDKIDTEVPAPADGVLLEVR
AEEGATVSAGSVIATIGEPGEQPQRPAEKETPAEPKHPGQSPDAGRSPALSPQAEDRPAG
RNFISPVVARMSAEHGIDLSKVTGTGLGGRITKKDLEAYLAGVRREVAEGEEGASEQAAA
PTTLGEDDVLQPLTAMRRAIAQHMVLSKRTSPHVTTICEVDMTNVVRHREANKRAYTRDG
AVLTYTAYFIVAAVAGLRAVPEANSRFTDAGIILHRRIHIGVAVALPDGLLVPVIRNADE
LSLAGIARTLNDLVNRTRNGLLKPDEVQGGTFTITNHGTGGSLFATPIINQPQSGILGVG
AIVKRPVVRSASSSLLPSADDVIAIRPMCYLSLTFDHRVMDGAQGDRFLTVVKQTLENWE
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggtcgtcaggatgccgcagctcggtgagagcgtcgtcgaaggcacgatctta
cgctggctgaaacagccaggcgatccgatcgtcaaaaacgagccgctgctggtcatcagc
acggacaaaatcgacaccgaagtgcctgcgccagcagacggggtattgcttgaagtaagg
gccgaagaaggcgccactgtatctgcaggctccgtgatcgccaccatcggcgagccggga
gagcaaccgcaacgacctgcagaaaaagaaacgccagcagagccaaagcacccaggccaa
tcgccggatgccggacgttcgcctgctctctcgcctcaagcggaggaccgaccggccgga
cgcaactttatcagcccggtggtggcacgcatgtccgccgagcacggcatcgatctgtca
aaggtcacaggaacgggccttggagggcgcatcaccaaaaaagacctcgaagcctatctt
gccggtgtacgccgcgaggtcgcagaaggtgaggagggagccagcgaacaggcggccgcg
ccgaccaccctcggcgaggatgatgtgctgcagccgttgactgccatgcgtcgtgccatc
gcgcaacacatggtgttgagtaaacgcaccagcccccacgtcaccaccatctgcgaagtg
gacatgaccaacgtcgtgcgccatcgcgaggctaacaagcgcgcctacacgcgcgatggc
gccgtgctcacctatacagcctacttcattgtggccgccgtggccggactgcgcgccgtg
ccggaagccaacagccgctttacggacgcaggcatcattctgcatcgccgcatccatatc
ggcgtggccgtggcgcttcccgacggcctgctcgtccctgtgattcgcaacgccgacgag
ttgagcctggccggcatcgcgcgcacgctcaacgatctggtcaaccgcacgcgcaacgga
ttgctcaaaccggacgaagttcaaggcggcacctttacgatcaccaatcatggcacgggt
ggcagcctctttgccacgccgattatcaatcaaccgcaaagcggcattcttggcgtcggc
gccatcgtcaagcggccggtcgtgcgcagcgccagctcttcgctccttcccagcgccgac
gatgtgatcgccatccggccgatgtgctacctcagcctcaccttcgatcatcgggtaatg
gatggggcgcagggcgacagatttttgacagtggtaaagcaaacattggaaaattgggaa
gcatag

DBGET integrated database retrieval system