KEGG   Caldilinea aerophila: CLDAP_39400Help
Entry
CLDAP_39400       CDS       T01797                                 

Definition
putative aldolase class II protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cap  Caldilinea aerophila
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CLDAP_39400
Enzymes [BR:cap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     CLDAP_39400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4940517..4941098
Genome map
AA seq 193 aa AA seqDB search
MFERRLTDIAGGNISVREDDKLYITPRYAGSKQHWQLAPADILCAPIGNDELLQHPRSSR
ESKMHLAVYRHYPDVGAVIHAHPFHVLPFCVAGRPIEPVLEGTQKFGVTPVAPFAPAHSE
ALGQHVVEMLRGREAVIRKQAAAVLLSKHGIVVAGLDLLAAVDALERIDWNAWCILSQSL
LPATTFAYTTTSS
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagcgtcgcctgaccgatatcgcaggtggcaacatcagcgtgcgagaggacgac
aagctttacatcacaccgcgctatgctggcagcaaacaacactggcagcttgcacccgcc
gatattctctgcgcaccgatcggcaacgatgaactcctgcaacatccgcgcagctcgcgt
gaaagcaagatgcatctggccgtgtatcggcactaccctgacgttggcgcagtgattcac
gctcatccgttccatgtgcttcccttttgcgtcgccggtcgcccgatcgagccggtgctg
gagggcacgcaaaaatttggggtgacgccggttgcaccctttgcgccagcgcacagcgag
gcgttggggcaacatgttgtggaaatgttgcgcggccgcgaggccgtcattcgtaaacag
gcggcggccgtgctgctctctaaacacggaatcgttgtcgcgggccttgacctgctcgcc
gcagttgacgccctggagcgcatcgactggaacgcctggtgcattctcagccagagcctg
ctgcctgccaccacgttcgcctatacaactacgtcatcatga

DBGET integrated database retrieval system