KEGG   Caldilinea aerophila: CLDAP_39510Help
Entry
CLDAP_39510       CDS       T01797                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cap  Caldilinea aerophila
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cap00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CLDAP_39510 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CLDAP_39510 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CLDAP_39510 (trpB)
Enzymes [BR:cap01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CLDAP_39510 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
4951728..4953098
Genome map
AA seq 456 aa AA seqDB search
MSQQTKFILSERDIPEKWYNIVADMPNKPLPPLHPATHQPIGPADLAPLFPMELIKQEVT
TETWVEIPEEVREVYKLWRPTPLYRARRLEKALDTPAKIYYKYEGVSPAGSHKPNTAVPQ
AYYNMKEGVKRITTETGAGQWGSALAFACNLFGVGCEIYMVRVSYEQKPYRKIMMNTWGA
EVYASPSNRTNAGRQILAQDPDSPGSLGIAISEAVEVAATNEDAKYSLGSVLNHVLMHQT
VIGQEAIKQLEMAGDFPDIVIAPFGGGSNFAGISFPFLRYKLTEGKPIRAIAVEPTSCPK
LTRGVFRYDFGDTVGMTPLLPMYTLGHTFVPAKIHAGGLRYHGAGVIVSQLLKDGIIEAL
AIDQVETFEAGVLFARTEGIIPAPEANHAIAQVIREAKRAREEGVSKTILFNLCGHGHFD
LAAYEAYFEGRLQKHEMTQEEIEAALAAIDTPPIPA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcaaactaaattcatcctgtcggagcgcgatattcccgaaaaatggtacaac
atcgtagcggacatgccgaacaagccattgccgccgctccatccggccacgcaccagccg
atcgggcctgccgacctggcgccgctctttccgatggagctgatcaaacaggaggtgacc
accgaaacatgggttgaaatccccgaagaggtacgtgaggtgtacaaactgtggcgcccc
acccctctctaccgcgcccgtcgcctggaaaaagcgctcgacacgccggccaaaatttat
tacaagtacgaaggtgtcagccccgctggttcacacaagcccaacactgccgtgccccag
gcctattacaacatgaaagagggggtcaaacgcatcactaccgagacaggcgccggccag
tggggcagcgcgcttgcctttgcctgcaacctgttcggcgtcggctgtgaaatttacatg
gtgcgcgtttcttacgagcagaagccctatcgcaaaatcatgatgaacacctggggcgcc
gaagtatatgcttcgccctccaaccgcaccaacgccgggcggcaaattctggcacaggat
cccgattcgccgggcagcctgggcatcgccatctccgaggcagtagaggtagcggctacc
aacgaggatgccaaatattcgttaggcagcgtgctcaaccacgtgttgatgcatcagacg
gtgatcggacaggaagcgatcaaacaactggagatggcgggcgactttcccgacattgtg
attgctccctttggcggtggctccaacttcgccggcatctccttccccttcttgcgctat
aagctgaccgagggcaaaccgatacgcgccatcgctgtagagccgacctcctgcccgaag
ctcacgcgcggggtcttccgctacgatttcggcgacaccgtcggcatgacacctctgctg
ccgatgtacacgttggggcataccttcgtgccggcgaagattcatgccggcggactgcgc
tatcatggcgcaggggtcatcgtgagccagttgctgaaagatgggatcatcgaagcgttg
gccatcgatcaggtcgaaaccttcgaggcgggcgtgctcttcgccaggacagaagggatc
atcccggccccggaagcgaatcacgccatcgcccaggtcattcgcgaggcaaagcgtgcc
agggaagaaggggtctccaagacgattctcttcaacctgtgtggccatggtcactttgac
cttgcggcgtacgaagcctattttgaaggccgcctgcagaaacacgagatgacccaggag
gagatcgaagcggcccttgctgcgatcgatacgcctcccatcccggcgtaa

DBGET integrated database retrieval system